habitarepro.fi
Detaljer
Källa: Finlands transport- och kommunikationsbyrå (Traficom) och Internet Assigned Numbers Authority (IANA)| Status | Registered |
| Hållare | Messuaukio 1, Finland |
| Beviljningsdatum | 2017-09-22 |
| Sista giltighetsdatum | 2024-09-22 |
| Registrator | Telia Finland Oyj 00520 Helsinki |
| Namnservrar Se DNS-avsnittet för detaljer | ns.nebula.fi ns2.nebula.fi |
| Är DNSSec i bruk | No |
| IANA detaljer för suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP
Källa: Faktisk webbsida - Tidsstämpel: 2022-10-31 19:10VARNING: Observera att platsen kan vara helt fel om servern använder t.ex. omvänd proxy som Cloudflare
| IP source | IP address | ASN block data | IP Geolocation |
|---|---|---|---|
| Användar-IP | 3.149.255.162 | Detta hämtas inte för tillfället | Country: United States (US) City: Postal code: Latitude: 37,751 Longitude: -97,822 Network: 3.144.0.0/12 |
| Server-IP | Autonomous System (AS) #: 29422 BGP prefix: 188.117.0.0/18 Country Code: FI Registry: ripencc Allocated: 2009-06-11 Info: NBLNETWORKS-AS Nebula Oy, FI | Country: Finland (FI) State: Uusimaa (18) City: Helsinki Postal code: 00720 Latitude: 60,2448 Longitude: 24,9912 Network: 188.117.16.0/20 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud för habitarepro.fi
Tyvärr, inte tillräckligt med data för att analysera ett ordmoln för denna webbplats just nu
Webbsida information för habitarepro.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-11-30 14:03| Header data & Metataggar | |
| Öppna graf (OG) metataggar | Att använda Open Graph-taggar rekommenderas starkt för sökmotoroptimering (SEO) |
| Twitter-kort | Att använda Twitter-taggar rekommenderas starkt för sökmotoroptimering (SEO) |
| Cascading Style Sheets (CSS) (CSS) | |
| Länkar till sociala medier (SOME) | Att ha innehåll i sociala medier rekommenderas starkt för sökmotoroptimering (SEO) |
| JavaScript-bibliotek |
Cookie-data för habitarepro.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-11-30 14:03Antal kakor: 13
| Cookie-domän | Cookievärden |
|---|---|
| ads.linkedin.com | Cookie name: lang Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 18 bitgrupper |
| fonts.net | Cookie name: __cf_bm Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 152 bitgrupper |
| habitare.messukeskus.com | Cookie name: advanced_ads_browser_width Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 30 bitgrupper |
| habitare.messukeskus.com | Cookie name: _hjIncludedInSessionSample Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 27 bitgrupper |
| habitare.messukeskus.com | Cookie name: _hjIncludedInPageviewSample Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 28 bitgrupper |
| linkedin.com | Cookie name: UserMatchHistory Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 94 bitgrupper |
| linkedin.com | Cookie name: AnalyticsSyncHistory Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 106 bitgrupper |
| linkedin.com | Cookie name: lang Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 18 bitgrupper |
| messukeskus.com | Cookie name: _gcl_au Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 32 bitgrupper |
| messukeskus.com | Cookie name: _hjSessionUser_417628 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 137 bitgrupper |
| messukeskus.com | Cookie name: _hjFirstSeen Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 13 bitgrupper |
| messukeskus.com | Cookie name: _hjSession_417628 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 133 bitgrupper |
| messukeskus.com | Cookie name: _hjAbsoluteSessionInProgress Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 29 bitgrupper |
Skärmdump för habitarepro.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-10-31 19:10
DNS-poster för habitarepro.fi
Källa: DNS-svar - Tidsstämpel: 2022-10-31 19:10| A | habitarepro.fi 188.117.27.178 (Time to Live: 7200) |
| NS | ns2.nebula.fi
|
| SOA | habitarepro.fi ns.nebula.fi (Time to Live: 7200) hostmaster.nebula.fi |
Whois rekordhistoria för habitarepro.fi
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Visar senaste max 5 upptäckte förändringar i posterna. Ändringar markeras
| Datum | 2021-01-19 | 2021-09-16 | 2022-09-16 | 2023-09-16 | 2023-10-04 |
|---|---|---|---|---|---|
| Name | habitarepro.fi | habitarepro.fi | habitarepro.fi | habitarepro.fi | habitarepro.fi |
| State | Registered | Registered | Registered | Registered | Registered |
| Holder | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta |
| Address | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 |
| Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
| GrantDate | 2017-09-22T16:16:16.783 | 2017-09-22T16:16:16.783 | 2017-09-22T16:16:16.783 | 2017-09-22T16:16:16.783 | 2017-09-22T16:16:16.783 |
| Registrar | Telia Inmics-Nebula Oy | Telia Inmics-Nebula Oy | Telia Inmics-Nebula Oy | Telia Inmics-Nebula Oy | Telia Finland Oyj |
| PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
| PostalCode | 00520 | 00520 | 00520 | 00520 | 00520 |
| NameServer1 | ns.nebula.fi | ns.nebula.fi | ns.nebula.fi | ns.nebula.fi | ns.nebula.fi |
| NameServer2 | ns2.nebula.fi | ns2.nebula.fi | ns2.nebula.fi | ns2.nebula.fi | ns2.nebula.fi |
| PhoneNumber | |||||
| IsDNSSecInUse | no | no | no | no | no |
| OrganizationId | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 |
| AssociationType | Company | Company | Company | Company | Company |
| LastValidityDate | 2021-09-22T16:16:16.783 | 2022-09-22T16:16:16.783 | 2023-09-22T16:16:16.783 | 2024-09-22T16:16:16.783 | 2024-09-22T16:16:16.783 |
| DepartmentOrContactPerson |
Server svar för habitarepro.fi
Källa: Webbserversvar - Tidsstämpel: 2022-10-31 19:10| Slutlig URL | http://www.habitarepro.fi/ |
| HTTP-returkod | HTTP/1.1 301 Moved Permanently |
| IP-adress | 188.117.27.178 Autonomous System (AS) #: 29422 BGP prefix: 188.117.0.0/18 Country Code: Finland (FI) Registry: ripencc Allocated: 2009-06-11 Info: NBLNETWORKS-AS Nebula Oy, FI |
| Serverhuvud | Server: Via: |
| Certifikat | Inte tillgänglig Att använda certifikat rekommenderas starkt för sökmotoroptimering (SEO) Om din webbplats har ett certifikat och du fortfarande ser denna varning betyder det att din webbserver inte är konfigurerad korrekt för att omdirigera trafik till en https-adress |
Begagnade tekniker på habitarepro.fi
Källa: Webbsideanalys - Tidsstämpel: 2022-10-31 19:10| Senaste recensionen | 2022-10-31 19:10 |
| Sidspråk (från rubrik) | en-US (Detta är ofta falskt!) |
| Technologies |  Elementor 3.8.0 (Landing Page Builders) (100% propable) Google Font API (Font Scripts) (100% propable) Nginx (Web ServersReverse Proxy) (100% propable) Swiper Slider (Miscellaneous) (100% propable) WP Rocket 3.11.0.5 (Cache Tools) (100% propable) WordPress 5.9.5 (CMSBlogs) (100% propable) Yoast SEO 19.9 (SEO) (100% propable) jQuery 3.6.5 (JavaScript Libraries) (100% propable) jQuery Migrate 3.3.2 (JavaScript Libraries) (100% propable) |
Kända underdomäner för habitarepro.fi
Källa: Sökmotorer och DNS-poster (MEDDELANDE: De flesta kanske inte kan nås (internt / DMZ / föråldrat)). Visar max rader 700Antal hittade underdomäner: 1
| Subdomain | IP-adress |
|---|---|
| www.habitarepro.fi | 188.117.27.178 |
Webbhotellleverantörer
Källa: Alla giltiga företagswebbplatser med innehåll (se tabellen nedan)
Domäner som ägs av samma ägare (nuvarande och tidigare)
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Antal domäner: 284
| Domän namn | Slutlig URL (när sist testades) | Länkar | Sista giltighet |
|---|---|---|---|
| 100ideaakevaaseen.fi | Utgånget 2023-01-27 | ||
| 55plus.fi | Inga DNS-poster hittades | 2025-02-09 | |
| agriexpo.fi | Utgånget 2023-11-23 | ||
| agrikone.fi | Utgånget 2023-11-23 | ||
| agrikonemessut.fi | Utgånget 2023-11-23 | ||
| agrimessut.fi | Utgånget 2023-11-23 | ||
| antiikkitapahtuma.fi | http://antiikki.messukeskus.com/ | 2024-11-27 | |
| apconfinland.fi | Utgånget 2021-08-16 | ||
| arenaexpo.fi | https://arena.messukeskus.com/ | 2024-06-14 | |
| asujaremontoi.fi | Inga DNS-poster hittades | 2024-10-25 | |
| atvmessut.fi | Utgånget 2023-03-29 | ||
| auto2017.fi | Utgånget 2000-12-31 | ||
| auto2019.fi | http://auto.messukeskus.com/ | 2026-02-08 | |
| auto2020.fi | Utgånget 2024-02-08 | ||
| auto2021.fi | Utgånget 2024-02-08 | ||
| auto2022.fi | Utgånget 2024-02-08 | ||
| autokorjaamomessut.fi | https://autokorjaamo.messukeskus.com/ | 2024-09-20 | |
| automaatiomessut.fi | Utgånget 2023-09-20 | ||
| auto-messut.fi | http://auto.messukeskus.com/ | 2025-01-26 | |
| båtmässa.fi | Inga DNS-poster hittades | 2024-09-01 | |
| beautyprocover.fi | http://iloveme.messukeskus.com/beauty-pro/ | 2025-05-03 | |
| beautypromessut.fi | Inga DNS-poster hittades | 2024-12-01 | |
| bioenergyexpo.fi | Utgånget 2023-11-18 | ||
| bioproductsexpo.fi | Utgånget 2023-11-18 | ||
| bisnespaivat.fi | Utgånget 2024-01-03 | ||
| bisnespäivät.fi | https://messukeskus.com/wp-signup.php?new=www.xn--bisnespivt... | 2026-01-03 | |
| bolearenaclub.fi | Inga DNS-poster hittades | 2025-05-11 | |
| bolearena.fi | Inga DNS-poster hittades | 2025-05-11 | |
| böle.fi | Inga DNS-poster hittades | 2025-05-11 | |
| businesstravelforum.fi | https://matka.messukeskus.com/b2b/ | 2024-05-22 | |
| caravanmessut.fi | https://caravan.messukeskus.com/ | 2024-09-20 | |
| chembiofinland.fi | http://chembio.messukeskus.com/ | 2025-02-19 | |
| congresscenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
| congresscentre.fi | Utgånget 2023-09-05 | ||
| conventioncenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
| conventioncentre.fi | https://messukeskus.com/wp-signup.php?new=www.conventioncent... | 2027-06-13 | |
| corefair.fi | Utgånget 2018-04-16 | ||
| coremessut.fi | Utgånget 2018-04-16 | ||
| digiexpo.fi | Utgånget 2024-02-19 | ||
| educafair.fi | Inga DNS-poster hittades | 2024-10-28 | |
| educamessut.fi | Inga DNS-poster hittades | 2025-04-07 | |
| elainystavani.fi | Inga DNS-poster hittades | 2025-05-20 | |
| eläinystäväni.fi | Inga DNS-poster hittades | 2025-05-20 | |
| elmamessut.fi | https://elma.messukeskus.com/ | 2024-09-05 | |
| eltekmessut.fi | Utgånget 2023-09-04 | ||
| emessukeskus.fi | http://www.emessukeskus.fi/ | 2025-03-27 | |
| enviroexpo.fi | Utgånget 2024-01-29 | ||
| facetoface.fi | Utgånget 2023-09-07 | ||
| fairnet.fi | Utgånget 2023-09-04 | ||
| fillarimessut.fi | https://goexpo.messukeskus.com/ | 2024-09-05 | |
| finlandsmassa.fi | Utgånget 2023-09-04 | ||
| finlandsmässa.fi | Utgånget 2023-09-01 | ||
| finnbuild.fi | Inga DNS-poster hittades | 2024-09-04 | |
| finnexpo.fi | Utgånget 2023-08-31 | ||
| finnishdentalexhibition.fi | Inga DNS-poster hittades | 2024-11-17 | |
| finnishfaircorporation.fi | https://messukeskus.com/wp-signup.php?new=www.finnishfaircor... | 2024-09-04 | |
| finnsec.fi | http://www.finnsec.fi/ | 2024-09-04 | |
| foodtechelsinki.fi | https://pfsptec.messukeskus.com/ | 2025-04-07 | |
| formakevat.fi | Utgånget 2023-09-03 | ||
| formakevät.fi | Utgånget 2023-09-03 | ||
| formasyksy.fi | Utgånget 2023-09-03 | ||
| funexpo.fi | http://www.funexpo.fi/ | 2024-09-28 | |
| gamexpo.fi | Utgånget 2023-11-17 | ||
| gastro.fi | Inga DNS-poster hittades | 2024-09-04 | |
| gastrohelsinki.fi | Inga DNS-poster hittades | 2025-03-20 | |
| gastropro.fi | https://gastro.messukeskus.com/ | 2024-11-01 | |
| globalworkshop.fi | https://matka.messukeskus.com/ | 2024-10-25 | |
| goexpo.fi | https://goexpo.messukeskus.com/ | 2025-12-04 | |
| goexpohorse.fi | Utgånget 2023-12-06 | ||
| goexpowinter.fi | Utgånget 2023-10-17 | ||
| golfexpo.fi | Utgånget 2024-03-05 | ||
| golfmessut.fi | https://golfmessut.fi/ | 2024-09-05 | |
| graftec.fi | Utgånget 2024-04-22 | ||
| growthhelsinki.fi | Utgånget 2023-02-07 | ||
| gswpro.fi | Utgånget 2000-12-31 | ||
| habitare.fi | Inga DNS-poster hittades | 2024-08-31 | |
| habitarepro.fi | http://www.habitarepro.fi/ | 2024-09-22 | |
| hammalääkäripäivätnäyttely.fi | Utgånget 2018-11-15 | ||
| hammaslaakaripaivatnayttely.fi | Inga DNS-poster hittades | 2024-11-15 | |
| hammaslääkäripäivätnäyttely.fi | https://hammaslaakaripaivat.messukeskus.com/ | 2024-11-25 | |
| helsingforsbokmassa.fi | https://kirjamessut.messukeskus.com/?lang=sv | 2024-09-05 | |
| helsingforsbokmässa.fi | https://messukeskus.com/wp-signup.php?new=www.xn--helsingfor... | 2024-09-01 | |
| helsingforsmasscentrum.fi | Inga DNS-poster hittades | 2024-09-04 | |
| helsingforsmässcentrum.fi | Utgånget 2019-09-01 | ||
| helsingineramessut.fi | Inga DNS-poster hittades | 2025-04-19 | |
| helsinginerämessut.fi | Inga DNS-poster hittades | 2025-04-19 | |
| helsinginkirjamessut.fi | https://kirjamessut.messukeskus.com/ | 2024-09-05 | |
| helsinginmessukeskus.fi | Inga DNS-poster hittades | 2024-08-31 | |
| helsinginmessut.fi | http://www.wanhasatama.com/ | 2024-08-31 | |
| helsinginmetsamessut.fi | Utgånget 2024-01-08 | ||
| helsinginmetsämessut.fi | Utgånget 2024-01-08 | ||
| helsinginmusiikkimessut.fi | Utgånget 2023-10-22 | ||
| helsinkiboatshow.fi | Inga DNS-poster hittades | 2024-11-17 | |
| helsinkibookfair.fi | Inga DNS-poster hittades | 2024-09-05 | |
| helsinkicf.fi | Inga DNS-poster hittades | 2025-04-07 | |
| helsinkiconventioncenter.fi | Inga DNS-poster hittades | 2025-06-13 | |
| helsinkiconventioncentre.fi | Inga DNS-poster hittades | 2025-06-13 | |
| helsinkiexhibitionandconventioncenter.fi | https://messukeskus.com/?lang=en | 2025-06-13 | |
| helsinkiexhibitionandconventioncentre.fi | http://www.helsinkiexhibitionandconventioncentre.fi/ | 2025-06-13 | |
| helsinkiexhibitioncenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
| helsinkiexhibitioncentre.fi | Inga DNS-poster hittades | 2025-06-13 | |
| helsinkifaircentre.fi | http://messukeskus.com/?lang=en | 2024-09-04 | |
| helsinkihorsefair.fi | http://www.helsinkihorsefair.fi/ | 2024-09-20 | |
| highendhelsinki.fi | Utgånget 2024-01-18 | ||
| highendhifi.fi | Utgånget 2024-01-16 | ||
| himss.fi | Inga DNS-poster hittades | 2024-11-16 | |
| horsefair.fi | Utgånget 2024-04-23 | ||
| hpmessut.fi | http://www.hpmessut.fi/ | 2024-06-07 | |
| hupicon.fi | Inga DNS-poster hittades | 2024-10-06 | |
| iloveme.fi | http://iloveme.messukeskus.com/ | 2025-01-18 | |
| infraexpo.fi | Utgånget 2024-01-31 | ||
| jatevesiymparisto.fi | Inga DNS-poster hittades | 2024-09-04 | |
| jätevesiympäristö.fi | http://www.xn--jtevesiymprist-5hbj42a.fi/ | 2024-09-04 | |
| jewelandwatch.fi | Utgånget 2023-11-27 | ||
| jobforum.fi | Utgånget 2023-10-22 | ||
| jointec.fi | Utgånget 2024-04-24 | ||
| jonnela.fi | Inga DNS-poster hittades | 2024-10-30 | |
| jonnelaklubi.fi | Inga DNS-poster hittades | 2024-10-30 | |
| julkinenateria.fi | https://ateria.messukeskus.com/ | 2024-11-25 | |
| julkisivumessut.fi | Utgånget 2019-01-18 | ||
| kadentaitotapahtuma.fi | Utgånget 2024-02-26 | ||
| kädentaitotapahtuma.fi | Utgånget 2024-02-26 | ||
| kalastusmessut.fi | Utgånget 2024-03-28 | ||
| kauneusmessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
| kevaanmerkit.fi | Utgånget 2024-03-30 | ||
| keväänmerkit.fi | Utgånget 2024-03-30 | ||
| kevatmessut.fi | http://www.kevatmessut.fi/ | 2025-01-08 | |
| kevätmessut.fi | http://www.xn--kevtmessut-s5a.fi/ | 2025-01-08 | |
| kevatpuutarha.fi | http://kevatmessut.messukeskus.com/ | 2024-09-04 | |
| kiinteistoklusteri.fi | Utgånget 2024-03-29 | ||
| kiinteistöklusteri.fi | Utgånget 2024-03-29 | ||
| kiinteistomessut.fi | http://www.kiinteistomessut.fi/ | 2024-09-20 | |
| kiinteistömessut.fi | Inga DNS-poster hittades | 2024-09-01 | |
| kiinteistoplusturvallisuus.fi | Utgånget 2024-03-05 | ||
| kiinteistöplusturvallisuus.fi | Utgånget 2024-03-05 | ||
| kokoustamo.fi | Utgånget 2023-09-25 | ||
| korjausjarakentaminen.fi | Utgånget 2023-09-07 | ||
| korjausrakentaminen2018.fi | Utgånget 2023-10-04 | ||
| korujakello.fi | Utgånget 2023-11-27 | ||
| korujakellomessut.fi | Utgånget 2023-11-27 | ||
| kuljetuslogistiikka.fi | Utgånget 2023-09-05 | ||
| kutsutapahtumaan.fi | Inga DNS-poster hittades | 2024-10-25 | |
| laakaripaivatnayttely.fi | https://laakaripaivat.messukeskus.com/ | 2024-09-20 | |
| lääkäripäivätnäyttely.fi | Inga DNS-poster hittades | 2025-09-01 | |
| lahiruokaluomu.fi | https://lahiruokajaluomu.messukeskus.com/ | 2024-09-21 | |
| lähiruokaluomu.fi | https://kevatmessut.messukeskus.com/ | 2024-09-21 | |
| lapsimessut.fi | https://lapsimessut.messukeskus.com/ | 2024-09-05 | |
| lautasella.fi | Inga DNS-poster hittades | 2025-06-08 | |
| lemmikkitapahtuma.fi | Inga DNS-poster hittades | 2024-12-16 | |
| liikelahjamessut.fi | Utgånget 2019-10-30 | ||
| liikelahjatmessut.fi | Utgånget 2019-10-30 | ||
| logistiikkakuljetus.fi | Utgånget 2023-09-05 | ||
| maatalouskonemessut.fi | https://maatalouskone.messukeskus.com/ | 2024-11-23 | |
| maintec.fi | Utgånget 2018-04-22 | ||
| manufacturingmaterials.fi | Utgånget 2023-10-30 | ||
| markkinoinninviikko.fi | Utgånget 2024-03-09 | ||
| matkahuutokauppa.fi | Utgånget 2019-12-13 | ||
| matkailupalkinto.fi | Utgånget 2018-11-30 | ||
| matkamessut.fi | Inga DNS-poster hittades | 2024-09-05 | |
| matkapro.fi | Inga DNS-poster hittades | 2024-11-20 | |
| maxpo.fi | http://www.maxpo.fi/ | 2024-09-04 | |
| mecatec.fi | Utgånget 2023-08-31 | ||
| meetfinland.fi | Inga DNS-poster hittades | 2024-09-28 | |
| meidanviikonloppu.fi | Utgånget 2024-02-18 | ||
| meidänviikonloppu.fi | Utgånget 2024-02-18 | ||
| mesoaja.fi | http://www.mesoaja.fi/ | 2024-07-31 | |
| messuhelmi.fi | Utgånget 2018-05-29 | ||
| messukeskus100.fi | Utgånget 2023-11-20 | ||
| messukeskushelsinki.fi | Inga DNS-poster hittades | 2024-10-10 | |
| messukirppis.fi | Utgånget 2019-02-06 | ||
| messuklubi.fi | Inga DNS-poster hittades | 2024-09-18 | |
| messukutsu.fi | Inga DNS-poster hittades | 2024-05-22 | |
| messumedia.fi | http://www.messumedia.fi/ | 2024-09-04 | |
| messuparkki.fi | Inga DNS-poster hittades | 2025-05-29 | |
| messut100.fi | Inga DNS-poster hittades | 2025-12-13 | |
| messutapahtumat.fi | Inga DNS-poster hittades | 2024-09-20 | |
| messuvalmennus.fi | Inga DNS-poster hittades | 2025-01-14 | |
| metsamessut.fi | https://metsa.messukeskus.com/ | 2025-05-16 | |
| metsämessut.fi | Inga DNS-poster hittades | 2024-05-16 | |
| metsastysmessut.fi | Utgånget 2024-04-22 | ||
| metsästysmessut.fi | Utgånget 2019-04-22 | ||
| model-expo.fi | Utgånget 2023-10-14 | ||
| modelexpo.fi | Utgånget 2023-10-14 | ||
| moottorikelkkamessut.fi | Utgånget 2024-03-29 | ||
| moottoripyoranayttely.fi | Utgånget 2024-02-19 | ||
| moottoripyöränäyttely.fi | Inga DNS-poster hittades | 2024-09-01 | |
| motokuume.fi | http://www.motokuume.fi/ | 2024-12-04 | |
| motokuumemittari.fi | Utgånget 2024-01-21 | ||
| mp-messut.fi | Inga DNS-poster hittades | 2024-09-29 | |
| mpmessut.fi | http://mp.messukeskus.com/ | 2025-02-21 | |
| mp-nayttely.fi | http://www.mp-nayttely.fi/ | 2025-02-19 | |
| mprock.fi | Utgånget 2023-06-21 | ||
| mpstars.fi | Utgånget 2023-11-02 | ||
| muotimessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
| nayttely.fi | Utgånget 2023-09-05 | ||
| nbe.fi | Utgånget 2023-09-11 | ||
| nordictravelfair.fi | http://matka.messukeskus.com/?lang=en | 2024-10-06 | |
| oispatalvi.fi | http://www.oispatalvi.fi/ | 2024-09-14 | |
| omakotimessut.fi | http://kevatmessut.messukeskus.com/ | 2024-09-20 | |
| omamokki.fi | Inga DNS-poster hittades | 2024-09-04 | |
| omamökki.fi | Inga DNS-poster hittades | 2024-09-01 | |
| omapiha.fi | Inga DNS-poster hittades | 2024-09-04 | |
| onseala.fi | Inga DNS-poster hittades | 2025-03-21 | |
| outdoorexpo.fi | http://www.outdoorexpo.fi/ | 2024-12-16 | |
| pactec.fi | Inga DNS-poster hittades | 2024-08-31 | |
| petrolcircus.fi | Inga DNS-poster hittades | 2024-11-17 | |
| plastexpo.fi | Utgånget 2023-09-24 | ||
| pomppulinnataivas.fi | Utgånget 2023-10-25 | ||
| pranabeats.fi | Utgånget 2019-10-13 | ||
| pratkakuume.fi | Utgånget 2018-06-08 | ||
| promoexpo.fi | Utgånget 2023-11-21 | ||
| pulpandbeyond.fi | Inga DNS-poster hittades | 2025-05-11 | |
| pulpaper.fi | Inga DNS-poster hittades | 2024-09-04 | |
| pwaexpo.fi | Utgånget 2021-04-27 | ||
| pwa.fi | Utgånget 2024-04-27 | ||
| reset16.fi | Utgånget 2020-01-29 | ||
| reset17.fi | Utgånget 2019-08-18 | ||
| reset2017.fi | Utgånget 2019-08-17 | ||
| retkimessut.fi | Utgånget 2024-02-19 | ||
| robtec.fi | Utgånget 2000-12-31 | ||
| ruokamessuthelsinki.fi | Inga DNS-poster hittades | 2025-01-09 | |
| sahko-electricity.fi | Inga DNS-poster hittades | 2025-03-25 | |
| sähkö-electricity.fi | Inga DNS-poster hittades | 2025-03-25 | |
| sahkoexpo.fi | http://www.sahkoexpo.fi/ | 2025-03-25 | |
| sähköexpo.fi | Inga DNS-poster hittades | 2025-03-25 | |
| sähkömessut.fi | Inga DNS-poster hittades | 2025-02-15 | |
| sairaanhoitajapaivatnayttely.fi | Inga DNS-poster hittades | 2025-04-20 | |
| sairaanhoitajapäivätnäyttely.fi | Inga DNS-poster hittades | 2025-04-20 | |
| seatechelsinki.fi | Utgånget 2000-12-31 | ||
| secd-day.fi | Inga DNS-poster hittades | 2025-02-19 | |
| seonala.fi | Inga DNS-poster hittades | 2025-04-19 | |
| showroomfair.fi | Utgånget 2023-11-23 | ||
| signtec.fi | Utgånget 2024-01-29 | ||
| sihteeriassistenttimessut.fi | Utgånget 2023-10-30 | ||
| sihteeriassistenttipaivat.fi | Utgånget 2023-10-30 | ||
| sihteeriassistenttipäivät.fi | Utgånget 2023-10-30 | ||
| sijoittaja23.fi | Inga DNS-poster hittades | 2025-05-15 | |
| sijoittaja25.fi | Inga DNS-poster hittades | 2025-05-15 | |
| sijoittaja26.fi | Inga DNS-poster hittades | 2025-05-15 | |
| sijoittaja27.fi | Inga DNS-poster hittades | 2025-05-15 | |
| sijoittajamessut.fi | https://sijoittajamessut.messukeskus.com/ | 2025-01-08 | |
| sisahuvipuisto.fi | Inga DNS-poster hittades | 2024-06-13 | |
| sisustamessut.fi | https://kevatmessut.messukeskus.com/ | 2024-06-14 | |
| sisustusmessut.fi | Utgånget 2024-03-28 | ||
| sporttitaivas.fi | https://messukeskus.com/wp-signup.php?new=www.sporttitaivas.... | 2024-06-15 | |
| studiamessut.fi | http://studia.messukeskus.com/ | 2024-10-29 | |
| suomenmessut.fi | http://messukeskus.com/ | 2024-08-31 | |
| suomenmetsamessut.fi | Inga DNS-poster hittades | 2025-07-03 | |
| suomenmetsämessut.fi | Inga DNS-poster hittades | 2024-07-03 | |
| suomenvideoviestinta.fi | http://www.suomenvideoviestinta.fi/ | 2024-08-24 | |
| svv.fi | https://svv.fi/ | 2024-09-04 | |
| tanssiviekoon.fi | Utgånget 2023-12-22 | ||
| teknologia17.fi | Utgånget 2019-03-19 | ||
| teknologia19.fi | Utgånget 2024-03-19 | ||
| teknologia21.fi | https://teknologia.messukeskus.com/ | 2024-10-16 | |
| teknologia22.fi | Inga DNS-poster hittades | 2024-09-28 | |
| teknologia23.fi | Inga DNS-poster hittades | 2025-02-20 | |
| teknologiatapahtuma.fi | Inga DNS-poster hittades | 2024-08-16 | |
| tempaudu.fi | Inga DNS-poster hittades | 2024-08-14 | |
| terveysmessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
| terveytesimessut.fi | Inga DNS-poster hittades | 2024-06-08 | |
| tooltec.fi | https://teknologia.messukeskus.com/ | 2026-05-08 | |
| travelfair.fi | http://www.travelfair.fi/ | 2024-10-06 | |
| tsigaboom.fi | https://tsigaboom.messukeskus.com/ | 2024-08-15 | |
| turvallisuus2021.fi | Utgånget 2023-04-09 | ||
| turvallisuusmessut2021.fi | Utgånget 2023-04-09 | ||
| turvallisuustapahtuma.fi | Inga DNS-poster hittades | 2024-09-27 | |
| valomessut.fi | http://www.valomessut.fi/ | 2027-03-30 | |
| valotapahtuma.fi | Utgånget 2024-03-30 | ||
| varipinta.fi | Utgånget 2023-09-05 | ||
| väripinta.fi | Utgånget 2023-09-01 | ||
| venemessut.fi | http://vene.messukeskus.com/ | 2024-09-04 | |
| vihertek.fi | Utgånget 2023-11-04 | ||
| viiniexpo.fi | Utgånget 2023-09-04 | ||
| viiniruoka.fi | http://www.viiniruoka.fi/ | 2025-04-28 | |
| visitmatka.fi | Inga DNS-poster hittades | 2024-08-31 | |
| winterexpo.fi | Utgånget 2023-10-17 | ||
| woodexpo.fi | Utgånget 2023-11-18 | ||
| ymparistomessut.fi | Utgånget 2023-09-05 | ||
| ympäristömessut.fi | Utgånget 2023-09-01 | ||
| ymparistotekniikkamessut.fi | http://www.ymparistotekniikkamessut.fi/ | 2024-06-06 | |
| ympäristötekniikkamessut.fi | https://messukeskus.com/wp-signup.php?new=www.xn--ympristtek... | 2024-06-06 | |
| yritys2017.fi | Utgånget 2021-02-03 | ||
| yritys2018.fi | Inga DNS-poster hittades | 2027-01-26 |