helsinginmessut.fi
Detaljer
Källa: Finlands transport- och kommunikationsbyrå (Traficom) och Internet Assigned Numbers Authority (IANA)Status | Registered |
Hållare | Messuaukio 1, Finland |
Beviljningsdatum | 1997-10-28 |
Sista giltighetsdatum | 2024-08-31 |
Registrator | Louhi Net Oy 00520 Helsinki |
Namnservrar Se DNS-avsnittet för detaljer | dns1.louhi.net dns2.louhi.net dns3.louhi.fi |
Är DNSSec i bruk | No |
IANA detaljer för suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP
Källa: Faktisk webbsida - Tidsstämpel: 2022-10-28 01:54VARNING: Observera att platsen kan vara helt fel om servern använder t.ex. omvänd proxy som Cloudflare
Server IP not valid or missing details in database. Map not shown
Word cloud för helsinginmessut.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-10-28 01:54Lägga märke till: Diverse ord tas bort från molnet för att förbättra analysen
Webbsida information för helsinginmessut.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-12-03 10:12Header data & Metataggar | title VIRHE: Pyydettyä URL-osoitetta ei voitu hakea not_found Copyright (C) 1996-2019 The Squid Software Foundation and contributorstext/html; charset=utf-8. |
Öppna graf (OG) metataggar | Att använda Open Graph-taggar rekommenderas starkt för sökmotoroptimering (SEO) |
Twitter-kort | Att använda Twitter-taggar rekommenderas starkt för sökmotoroptimering (SEO) |
Cascading Style Sheets (CSS) (CSS) | |
Länkar till sociala medier (SOME) | Att ha innehåll i sociala medier rekommenderas starkt för sökmotoroptimering (SEO) |
JavaScript-bibliotek |
Cookie-data för helsinginmessut.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-12-03 10:12Antal kakor: 0
Cookie-domän | Cookievärden |
---|
Skärmdump för helsinginmessut.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-10-28 01:54
DNS-poster för helsinginmessut.fi
Källa: DNS-svar - Tidsstämpel: 2022-10-28 01:54A | helsinginmessut.fi 188.117.27.178 (Time to Live: 3600) |
MX | helsinginmessut.fi (Time to Live: 3600) |
NS | dns2.louhi.net
|
SOA | helsinginmessut.fi dns1.louhi.net (Time to Live: 3600) hostmaster.louhi.net |
Whois rekordhistoria för helsinginmessut.fi
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Visar senaste max 5 upptäckte förändringar i posterna. Ändringar markeras
Datum | 2020-05-16 | 2021-01-19 | 2021-05-16 | 2022-05-13 | 2023-05-13 |
---|---|---|---|---|---|
Name | helsinginmessut.fi | helsinginmessut.fi | helsinginmessut.fi | helsinginmessut.fi | helsinginmessut.fi |
State | Registered | Registered | Registered | Registered | Registered |
Holder | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta |
Address | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 1997-10-28T14:49:00 | 1997-10-28T14:49:00 | 1997-10-28T14:49:00 | 1997-10-28T14:49:00 | 1997-10-28T14:49:00 |
Registrar | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy |
PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
PostalCode | 00520 | 00520 | 00520 | 00520 | 00520 |
NameServer1 | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net |
NameServer2 | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net |
NameServer3 | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi |
PhoneNumber | +358404503250 | ||||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2021-08-31T00:00:00 | 2021-08-31T00:00:00 | 2022-08-31T00:00:00 | 2023-08-31T00:00:00 | 2024-08-31T00:00:00 |
DepartmentOrContactPerson |
Server svar för helsinginmessut.fi
Källa: Webbserversvar - Tidsstämpel: 2022-10-28 01:54Slutlig URL | http://www.wanhasatama.com/ |
HTTP-returkod | |
IP-adress | |
Serverhuvud | Server: Via: |
Certifikat | Inte tillgänglig Att använda certifikat rekommenderas starkt för sökmotoroptimering (SEO) Om din webbplats har ett certifikat och du fortfarande ser denna varning betyder det att din webbserver inte är konfigurerad korrekt för att omdirigera trafik till en https-adress |
Begagnade tekniker på helsinginmessut.fi
Källa: Webbsideanalys - Tidsstämpel: 2022-10-28 01:54Senaste recensionen | 2022-10-28 01:54 |
Sidspråk (från rubrik) | (Detta är ofta falskt!) |
Technologies | Nginx (Web ServersReverse Proxy) (100% propable) |
Kända underdomäner för helsinginmessut.fi
Källa: Sökmotorer och DNS-poster (MEDDELANDE: De flesta kanske inte kan nås (internt / DMZ / föråldrat)). Visar max rader 700Antal hittade underdomäner: 139
Subdomain | IP-adress |
---|---|
eunet-gw.helsinginmessut.fi | |
net129.helsinginmessut.fi | |
net130.helsinginmessut.fi | |
net131.helsinginmessut.fi | |
net132.helsinginmessut.fi | |
net133.helsinginmessut.fi | |
net134.helsinginmessut.fi | |
net135.helsinginmessut.fi | |
net136.helsinginmessut.fi | |
net137.helsinginmessut.fi | |
net138.helsinginmessut.fi | |
net139.helsinginmessut.fi | |
net140.helsinginmessut.fi | |
net141.helsinginmessut.fi | |
net142.helsinginmessut.fi | |
net143.helsinginmessut.fi | |
net144.helsinginmessut.fi | |
net145.helsinginmessut.fi | |
net146.helsinginmessut.fi | |
net147.helsinginmessut.fi | |
net148.helsinginmessut.fi | |
net149.helsinginmessut.fi | |
net150.helsinginmessut.fi | |
net151.helsinginmessut.fi | |
net152.helsinginmessut.fi | |
net153.helsinginmessut.fi | |
net154.helsinginmessut.fi | |
net155.helsinginmessut.fi | |
net156.helsinginmessut.fi | |
net157.helsinginmessut.fi | |
net158.helsinginmessut.fi | |
net159.helsinginmessut.fi | |
net160.helsinginmessut.fi | |
net161.helsinginmessut.fi | |
net162.helsinginmessut.fi | |
net163.helsinginmessut.fi | |
net164.helsinginmessut.fi | |
net165.helsinginmessut.fi | |
net166.helsinginmessut.fi | |
net167.helsinginmessut.fi | |
net168.helsinginmessut.fi | |
net169.helsinginmessut.fi | |
net170.helsinginmessut.fi | |
net171.helsinginmessut.fi | |
net172.helsinginmessut.fi | |
net173.helsinginmessut.fi | |
net174.helsinginmessut.fi | |
net175.helsinginmessut.fi | |
net176.helsinginmessut.fi | |
net177.helsinginmessut.fi | |
net178.helsinginmessut.fi | |
net179.helsinginmessut.fi | |
net180.helsinginmessut.fi | |
net181.helsinginmessut.fi | |
net182.helsinginmessut.fi | |
net183.helsinginmessut.fi | |
net184.helsinginmessut.fi | |
net185.helsinginmessut.fi | |
net186.helsinginmessut.fi | |
net187.helsinginmessut.fi | |
net188.helsinginmessut.fi | |
net189.helsinginmessut.fi | |
net209.helsinginmessut.fi | |
net210.helsinginmessut.fi | |
net211.helsinginmessut.fi | |
net212.helsinginmessut.fi | |
net213.helsinginmessut.fi | |
net214.helsinginmessut.fi | |
net215.helsinginmessut.fi | |
net216.helsinginmessut.fi | |
net217.helsinginmessut.fi | |
net218.helsinginmessut.fi | |
net219.helsinginmessut.fi | |
net220.helsinginmessut.fi | |
net221.helsinginmessut.fi | |
net222.helsinginmessut.fi | |
ws128.helsinginmessut.fi | |
ws129.helsinginmessut.fi | |
ws130.helsinginmessut.fi | |
ws131.helsinginmessut.fi | |
ws132.helsinginmessut.fi | |
ws133.helsinginmessut.fi | |
ws134.helsinginmessut.fi | |
ws135.helsinginmessut.fi | |
ws136.helsinginmessut.fi | |
ws137.helsinginmessut.fi | |
ws138.helsinginmessut.fi | |
ws139.helsinginmessut.fi | |
ws140.helsinginmessut.fi | |
ws141.helsinginmessut.fi | |
ws142.helsinginmessut.fi | |
ws143.helsinginmessut.fi | |
ws144.helsinginmessut.fi | |
ws145.helsinginmessut.fi | |
ws146.helsinginmessut.fi | |
ws147.helsinginmessut.fi | |
ws148.helsinginmessut.fi | |
ws149.helsinginmessut.fi | |
ws150.helsinginmessut.fi | |
ws151.helsinginmessut.fi | |
ws152.helsinginmessut.fi | |
ws153.helsinginmessut.fi | |
ws154.helsinginmessut.fi | |
ws155.helsinginmessut.fi | |
ws156.helsinginmessut.fi | |
ws157.helsinginmessut.fi | |
ws158.helsinginmessut.fi | |
ws159.helsinginmessut.fi | |
ws160.helsinginmessut.fi | |
ws161.helsinginmessut.fi | |
ws162.helsinginmessut.fi | |
ws163.helsinginmessut.fi | |
ws164.helsinginmessut.fi | |
ws165.helsinginmessut.fi | |
ws166.helsinginmessut.fi | |
ws167.helsinginmessut.fi | |
ws168.helsinginmessut.fi | |
ws169.helsinginmessut.fi | |
ws171.helsinginmessut.fi | |
ws172.helsinginmessut.fi | |
ws173.helsinginmessut.fi | |
ws174.helsinginmessut.fi | |
ws175.helsinginmessut.fi | |
ws176.helsinginmessut.fi | |
ws177.helsinginmessut.fi | |
ws178.helsinginmessut.fi | |
ws179.helsinginmessut.fi | |
ws180.helsinginmessut.fi | |
ws181.helsinginmessut.fi | |
ws182.helsinginmessut.fi | |
ws183.helsinginmessut.fi | |
ws184.helsinginmessut.fi | |
ws185.helsinginmessut.fi | |
ws186.helsinginmessut.fi | |
ws187.helsinginmessut.fi | |
ws188.helsinginmessut.fi | |
ws189.helsinginmessut.fi | |
ws190.helsinginmessut.fi | |
ws191.helsinginmessut.fi |
Webbhotellleverantörer
Källa: Alla giltiga företagswebbplatser med innehåll (se tabellen nedan)
Domäner som ägs av samma ägare (nuvarande och tidigare)
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Antal domäner: 284
Domän namn | Slutlig URL (när sist testades) | Länkar | Sista giltighet |
---|---|---|---|
100ideaakevaaseen.fi | Utgånget 2023-01-27 | ||
55plus.fi | Inga DNS-poster hittades | 2025-02-09 | |
agriexpo.fi | Utgånget 2023-11-23 | ||
agrikone.fi | Utgånget 2023-11-23 | ||
agrikonemessut.fi | Utgånget 2023-11-23 | ||
agrimessut.fi | Utgånget 2023-11-23 | ||
antiikkitapahtuma.fi | http://antiikki.messukeskus.com/ | 2024-11-27 | |
apconfinland.fi | Utgånget 2021-08-16 | ||
arenaexpo.fi | https://arena.messukeskus.com/ | 2024-06-14 | |
asujaremontoi.fi | Inga DNS-poster hittades | 2024-10-25 | |
atvmessut.fi | Utgånget 2023-03-29 | ||
auto2017.fi | Utgånget 2000-12-31 | ||
auto2019.fi | http://auto.messukeskus.com/ | 2026-02-08 | |
auto2020.fi | Utgånget 2024-02-08 | ||
auto2021.fi | Utgånget 2024-02-08 | ||
auto2022.fi | Utgånget 2024-02-08 | ||
autokorjaamomessut.fi | https://autokorjaamo.messukeskus.com/ | 2024-09-20 | |
automaatiomessut.fi | Utgånget 2023-09-20 | ||
auto-messut.fi | http://auto.messukeskus.com/ | 2025-01-26 | |
båtmässa.fi | Inga DNS-poster hittades | 2024-09-01 | |
beautyprocover.fi | http://iloveme.messukeskus.com/beauty-pro/ | 2025-05-03 | |
beautypromessut.fi | Inga DNS-poster hittades | 2024-12-01 | |
bioenergyexpo.fi | Utgånget 2023-11-18 | ||
bioproductsexpo.fi | Utgånget 2023-11-18 | ||
bisnespaivat.fi | Utgånget 2024-01-03 | ||
bisnespäivät.fi | https://messukeskus.com/wp-signup.php?new=www.xn--bisnespivt... | 2026-01-03 | |
bolearenaclub.fi | Inga DNS-poster hittades | 2025-05-11 | |
bolearena.fi | Inga DNS-poster hittades | 2025-05-11 | |
böle.fi | Inga DNS-poster hittades | 2025-05-11 | |
businesstravelforum.fi | https://matka.messukeskus.com/b2b/ | 2024-05-22 | |
caravanmessut.fi | https://caravan.messukeskus.com/ | 2024-09-20 | |
chembiofinland.fi | http://chembio.messukeskus.com/ | 2025-02-19 | |
congresscenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
congresscentre.fi | Utgånget 2023-09-05 | ||
conventioncenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
conventioncentre.fi | https://messukeskus.com/wp-signup.php?new=www.conventioncent... | 2027-06-13 | |
corefair.fi | Utgånget 2018-04-16 | ||
coremessut.fi | Utgånget 2018-04-16 | ||
digiexpo.fi | Utgånget 2024-02-19 | ||
educafair.fi | Inga DNS-poster hittades | 2024-10-28 | |
educamessut.fi | Inga DNS-poster hittades | 2025-04-07 | |
elainystavani.fi | Inga DNS-poster hittades | 2025-05-20 | |
eläinystäväni.fi | Inga DNS-poster hittades | 2025-05-20 | |
elmamessut.fi | https://elma.messukeskus.com/ | 2024-09-05 | |
eltekmessut.fi | Utgånget 2023-09-04 | ||
emessukeskus.fi | http://www.emessukeskus.fi/ | 2025-03-27 | |
enviroexpo.fi | Utgånget 2024-01-29 | ||
facetoface.fi | Utgånget 2023-09-07 | ||
fairnet.fi | Utgånget 2023-09-04 | ||
fillarimessut.fi | https://goexpo.messukeskus.com/ | 2024-09-05 | |
finlandsmassa.fi | Utgånget 2023-09-04 | ||
finlandsmässa.fi | Utgånget 2023-09-01 | ||
finnbuild.fi | Inga DNS-poster hittades | 2024-09-04 | |
finnexpo.fi | Utgånget 2023-08-31 | ||
finnishdentalexhibition.fi | Inga DNS-poster hittades | 2024-11-17 | |
finnishfaircorporation.fi | https://messukeskus.com/wp-signup.php?new=www.finnishfaircor... | 2024-09-04 | |
finnsec.fi | http://www.finnsec.fi/ | 2024-09-04 | |
foodtechelsinki.fi | https://pfsptec.messukeskus.com/ | 2025-04-07 | |
formakevat.fi | Utgånget 2023-09-03 | ||
formakevät.fi | Utgånget 2023-09-03 | ||
formasyksy.fi | Utgånget 2023-09-03 | ||
funexpo.fi | http://www.funexpo.fi/ | 2024-09-28 | |
gamexpo.fi | Utgånget 2023-11-17 | ||
gastro.fi | Inga DNS-poster hittades | 2024-09-04 | |
gastrohelsinki.fi | Inga DNS-poster hittades | 2025-03-20 | |
gastropro.fi | https://gastro.messukeskus.com/ | 2024-11-01 | |
globalworkshop.fi | https://matka.messukeskus.com/ | 2024-10-25 | |
goexpo.fi | https://goexpo.messukeskus.com/ | 2025-12-04 | |
goexpohorse.fi | Utgånget 2023-12-06 | ||
goexpowinter.fi | Utgånget 2023-10-17 | ||
golfexpo.fi | Utgånget 2024-03-05 | ||
golfmessut.fi | https://golfmessut.fi/ | 2024-09-05 | |
graftec.fi | Utgånget 2024-04-22 | ||
growthhelsinki.fi | Utgånget 2023-02-07 | ||
gswpro.fi | Utgånget 2000-12-31 | ||
habitare.fi | Inga DNS-poster hittades | 2024-08-31 | |
habitarepro.fi | http://www.habitarepro.fi/ | 2024-09-22 | |
hammalääkäripäivätnäyttely.fi | Utgånget 2018-11-15 | ||
hammaslaakaripaivatnayttely.fi | Inga DNS-poster hittades | 2024-11-15 | |
hammaslääkäripäivätnäyttely.fi | https://hammaslaakaripaivat.messukeskus.com/ | 2024-11-25 | |
helsingforsbokmassa.fi | https://kirjamessut.messukeskus.com/?lang=sv | 2024-09-05 | |
helsingforsbokmässa.fi | https://messukeskus.com/wp-signup.php?new=www.xn--helsingfor... | 2024-09-01 | |
helsingforsmasscentrum.fi | Inga DNS-poster hittades | 2024-09-04 | |
helsingforsmässcentrum.fi | Utgånget 2019-09-01 | ||
helsingineramessut.fi | Inga DNS-poster hittades | 2025-04-19 | |
helsinginerämessut.fi | Inga DNS-poster hittades | 2025-04-19 | |
helsinginkirjamessut.fi | https://kirjamessut.messukeskus.com/ | 2024-09-05 | |
helsinginmessukeskus.fi | Inga DNS-poster hittades | 2024-08-31 | |
helsinginmessut.fi | http://www.wanhasatama.com/ | 2024-08-31 | |
helsinginmetsamessut.fi | Utgånget 2024-01-08 | ||
helsinginmetsämessut.fi | Utgånget 2024-01-08 | ||
helsinginmusiikkimessut.fi | Utgånget 2023-10-22 | ||
helsinkiboatshow.fi | Inga DNS-poster hittades | 2024-11-17 | |
helsinkibookfair.fi | Inga DNS-poster hittades | 2024-09-05 | |
helsinkicf.fi | Inga DNS-poster hittades | 2025-04-07 | |
helsinkiconventioncenter.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkiconventioncentre.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkiexhibitionandconventioncenter.fi | https://messukeskus.com/?lang=en | 2025-06-13 | |
helsinkiexhibitionandconventioncentre.fi | http://www.helsinkiexhibitionandconventioncentre.fi/ | 2025-06-13 | |
helsinkiexhibitioncenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
helsinkiexhibitioncentre.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkifaircentre.fi | http://messukeskus.com/?lang=en | 2024-09-04 | |
helsinkihorsefair.fi | http://www.helsinkihorsefair.fi/ | 2024-09-20 | |
highendhelsinki.fi | Utgånget 2024-01-18 | ||
highendhifi.fi | Utgånget 2024-01-16 | ||
himss.fi | Inga DNS-poster hittades | 2024-11-16 | |
horsefair.fi | Utgånget 2024-04-23 | ||
hpmessut.fi | http://www.hpmessut.fi/ | 2024-06-07 | |
hupicon.fi | Inga DNS-poster hittades | 2024-10-06 | |
iloveme.fi | http://iloveme.messukeskus.com/ | 2025-01-18 | |
infraexpo.fi | Utgånget 2024-01-31 | ||
jatevesiymparisto.fi | Inga DNS-poster hittades | 2024-09-04 | |
jätevesiympäristö.fi | http://www.xn--jtevesiymprist-5hbj42a.fi/ | 2024-09-04 | |
jewelandwatch.fi | Utgånget 2023-11-27 | ||
jobforum.fi | Utgånget 2023-10-22 | ||
jointec.fi | Utgånget 2024-04-24 | ||
jonnela.fi | Inga DNS-poster hittades | 2024-10-30 | |
jonnelaklubi.fi | Inga DNS-poster hittades | 2024-10-30 | |
julkinenateria.fi | https://ateria.messukeskus.com/ | 2024-11-25 | |
julkisivumessut.fi | Utgånget 2019-01-18 | ||
kadentaitotapahtuma.fi | Utgånget 2024-02-26 | ||
kädentaitotapahtuma.fi | Utgånget 2024-02-26 | ||
kalastusmessut.fi | Utgånget 2024-03-28 | ||
kauneusmessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
kevaanmerkit.fi | Utgånget 2024-03-30 | ||
keväänmerkit.fi | Utgånget 2024-03-30 | ||
kevatmessut.fi | http://www.kevatmessut.fi/ | 2025-01-08 | |
kevätmessut.fi | http://www.xn--kevtmessut-s5a.fi/ | 2025-01-08 | |
kevatpuutarha.fi | http://kevatmessut.messukeskus.com/ | 2024-09-04 | |
kiinteistoklusteri.fi | Utgånget 2024-03-29 | ||
kiinteistöklusteri.fi | Utgånget 2024-03-29 | ||
kiinteistomessut.fi | http://www.kiinteistomessut.fi/ | 2024-09-20 | |
kiinteistömessut.fi | Inga DNS-poster hittades | 2024-09-01 | |
kiinteistoplusturvallisuus.fi | Utgånget 2024-03-05 | ||
kiinteistöplusturvallisuus.fi | Utgånget 2024-03-05 | ||
kokoustamo.fi | Utgånget 2023-09-25 | ||
korjausjarakentaminen.fi | Utgånget 2023-09-07 | ||
korjausrakentaminen2018.fi | Utgånget 2023-10-04 | ||
korujakello.fi | Utgånget 2023-11-27 | ||
korujakellomessut.fi | Utgånget 2023-11-27 | ||
kuljetuslogistiikka.fi | Utgånget 2023-09-05 | ||
kutsutapahtumaan.fi | Inga DNS-poster hittades | 2024-10-25 | |
laakaripaivatnayttely.fi | https://laakaripaivat.messukeskus.com/ | 2024-09-20 | |
lääkäripäivätnäyttely.fi | Inga DNS-poster hittades | 2025-09-01 | |
lahiruokaluomu.fi | https://lahiruokajaluomu.messukeskus.com/ | 2024-09-21 | |
lähiruokaluomu.fi | https://kevatmessut.messukeskus.com/ | 2024-09-21 | |
lapsimessut.fi | https://lapsimessut.messukeskus.com/ | 2024-09-05 | |
lautasella.fi | Inga DNS-poster hittades | 2025-06-08 | |
lemmikkitapahtuma.fi | Inga DNS-poster hittades | 2024-12-16 | |
liikelahjamessut.fi | Utgånget 2019-10-30 | ||
liikelahjatmessut.fi | Utgånget 2019-10-30 | ||
logistiikkakuljetus.fi | Utgånget 2023-09-05 | ||
maatalouskonemessut.fi | https://maatalouskone.messukeskus.com/ | 2024-11-23 | |
maintec.fi | Utgånget 2018-04-22 | ||
manufacturingmaterials.fi | Utgånget 2023-10-30 | ||
markkinoinninviikko.fi | Utgånget 2024-03-09 | ||
matkahuutokauppa.fi | Utgånget 2019-12-13 | ||
matkailupalkinto.fi | Utgånget 2018-11-30 | ||
matkamessut.fi | Inga DNS-poster hittades | 2024-09-05 | |
matkapro.fi | Inga DNS-poster hittades | 2024-11-20 | |
maxpo.fi | http://www.maxpo.fi/ | 2024-09-04 | |
mecatec.fi | Utgånget 2023-08-31 | ||
meetfinland.fi | Inga DNS-poster hittades | 2024-09-28 | |
meidanviikonloppu.fi | Utgånget 2024-02-18 | ||
meidänviikonloppu.fi | Utgånget 2024-02-18 | ||
mesoaja.fi | http://www.mesoaja.fi/ | 2024-07-31 | |
messuhelmi.fi | Utgånget 2018-05-29 | ||
messukeskus100.fi | Utgånget 2023-11-20 | ||
messukeskushelsinki.fi | Inga DNS-poster hittades | 2024-10-10 | |
messukirppis.fi | Utgånget 2019-02-06 | ||
messuklubi.fi | Inga DNS-poster hittades | 2024-09-18 | |
messukutsu.fi | Inga DNS-poster hittades | 2024-05-22 | |
messumedia.fi | http://www.messumedia.fi/ | 2024-09-04 | |
messuparkki.fi | Inga DNS-poster hittades | 2025-05-29 | |
messut100.fi | Inga DNS-poster hittades | 2025-12-13 | |
messutapahtumat.fi | Inga DNS-poster hittades | 2024-09-20 | |
messuvalmennus.fi | Inga DNS-poster hittades | 2025-01-14 | |
metsamessut.fi | https://metsa.messukeskus.com/ | 2025-05-16 | |
metsämessut.fi | Inga DNS-poster hittades | 2024-05-16 | |
metsastysmessut.fi | Utgånget 2024-04-22 | ||
metsästysmessut.fi | Utgånget 2019-04-22 | ||
model-expo.fi | Utgånget 2023-10-14 | ||
modelexpo.fi | Utgånget 2023-10-14 | ||
moottorikelkkamessut.fi | Utgånget 2024-03-29 | ||
moottoripyoranayttely.fi | Utgånget 2024-02-19 | ||
moottoripyöränäyttely.fi | Inga DNS-poster hittades | 2024-09-01 | |
motokuume.fi | http://www.motokuume.fi/ | 2024-12-04 | |
motokuumemittari.fi | Utgånget 2024-01-21 | ||
mp-messut.fi | Inga DNS-poster hittades | 2024-09-29 | |
mpmessut.fi | http://mp.messukeskus.com/ | 2025-02-21 | |
mp-nayttely.fi | http://www.mp-nayttely.fi/ | 2025-02-19 | |
mprock.fi | Utgånget 2023-06-21 | ||
mpstars.fi | Utgånget 2023-11-02 | ||
muotimessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
nayttely.fi | Utgånget 2023-09-05 | ||
nbe.fi | Utgånget 2023-09-11 | ||
nordictravelfair.fi | http://matka.messukeskus.com/?lang=en | 2024-10-06 | |
oispatalvi.fi | http://www.oispatalvi.fi/ | 2024-09-14 | |
omakotimessut.fi | http://kevatmessut.messukeskus.com/ | 2024-09-20 | |
omamokki.fi | Inga DNS-poster hittades | 2024-09-04 | |
omamökki.fi | Inga DNS-poster hittades | 2024-09-01 | |
omapiha.fi | Inga DNS-poster hittades | 2024-09-04 | |
onseala.fi | Inga DNS-poster hittades | 2025-03-21 | |
outdoorexpo.fi | http://www.outdoorexpo.fi/ | 2024-12-16 | |
pactec.fi | Inga DNS-poster hittades | 2024-08-31 | |
petrolcircus.fi | Inga DNS-poster hittades | 2024-11-17 | |
plastexpo.fi | Utgånget 2023-09-24 | ||
pomppulinnataivas.fi | Utgånget 2023-10-25 | ||
pranabeats.fi | Utgånget 2019-10-13 | ||
pratkakuume.fi | Utgånget 2018-06-08 | ||
promoexpo.fi | Utgånget 2023-11-21 | ||
pulpandbeyond.fi | Inga DNS-poster hittades | 2025-05-11 | |
pulpaper.fi | Inga DNS-poster hittades | 2024-09-04 | |
pwaexpo.fi | Utgånget 2021-04-27 | ||
pwa.fi | Utgånget 2024-04-27 | ||
reset16.fi | Utgånget 2020-01-29 | ||
reset17.fi | Utgånget 2019-08-18 | ||
reset2017.fi | Utgånget 2019-08-17 | ||
retkimessut.fi | Utgånget 2024-02-19 | ||
robtec.fi | Utgånget 2000-12-31 | ||
ruokamessuthelsinki.fi | Inga DNS-poster hittades | 2025-01-09 | |
sahko-electricity.fi | Inga DNS-poster hittades | 2025-03-25 | |
sähkö-electricity.fi | Inga DNS-poster hittades | 2025-03-25 | |
sahkoexpo.fi | http://www.sahkoexpo.fi/ | 2025-03-25 | |
sähköexpo.fi | Inga DNS-poster hittades | 2025-03-25 | |
sähkömessut.fi | Inga DNS-poster hittades | 2025-02-15 | |
sairaanhoitajapaivatnayttely.fi | Inga DNS-poster hittades | 2025-04-20 | |
sairaanhoitajapäivätnäyttely.fi | Inga DNS-poster hittades | 2025-04-20 | |
seatechelsinki.fi | Utgånget 2000-12-31 | ||
secd-day.fi | Inga DNS-poster hittades | 2025-02-19 | |
seonala.fi | Inga DNS-poster hittades | 2025-04-19 | |
showroomfair.fi | Utgånget 2023-11-23 | ||
signtec.fi | Utgånget 2024-01-29 | ||
sihteeriassistenttimessut.fi | Utgånget 2023-10-30 | ||
sihteeriassistenttipaivat.fi | Utgånget 2023-10-30 | ||
sihteeriassistenttipäivät.fi | Utgånget 2023-10-30 | ||
sijoittaja23.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja25.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja26.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja27.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittajamessut.fi | https://sijoittajamessut.messukeskus.com/ | 2025-01-08 | |
sisahuvipuisto.fi | Inga DNS-poster hittades | 2024-06-13 | |
sisustamessut.fi | https://kevatmessut.messukeskus.com/ | 2024-06-14 | |
sisustusmessut.fi | Utgånget 2024-03-28 | ||
sporttitaivas.fi | https://messukeskus.com/wp-signup.php?new=www.sporttitaivas.... | 2024-06-15 | |
studiamessut.fi | http://studia.messukeskus.com/ | 2024-10-29 | |
suomenmessut.fi | http://messukeskus.com/ | 2024-08-31 | |
suomenmetsamessut.fi | Inga DNS-poster hittades | 2025-07-03 | |
suomenmetsämessut.fi | Inga DNS-poster hittades | 2024-07-03 | |
suomenvideoviestinta.fi | http://www.suomenvideoviestinta.fi/ | 2024-08-24 | |
svv.fi | https://svv.fi/ | 2024-09-04 | |
tanssiviekoon.fi | Utgånget 2023-12-22 | ||
teknologia17.fi | Utgånget 2019-03-19 | ||
teknologia19.fi | Utgånget 2024-03-19 | ||
teknologia21.fi | https://teknologia.messukeskus.com/ | 2024-10-16 | |
teknologia22.fi | Inga DNS-poster hittades | 2024-09-28 | |
teknologia23.fi | Inga DNS-poster hittades | 2025-02-20 | |
teknologiatapahtuma.fi | Inga DNS-poster hittades | 2024-08-16 | |
tempaudu.fi | Inga DNS-poster hittades | 2024-08-14 | |
terveysmessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
terveytesimessut.fi | Inga DNS-poster hittades | 2024-06-08 | |
tooltec.fi | https://teknologia.messukeskus.com/ | 2026-05-08 | |
travelfair.fi | http://www.travelfair.fi/ | 2024-10-06 | |
tsigaboom.fi | https://tsigaboom.messukeskus.com/ | 2024-08-15 | |
turvallisuus2021.fi | Utgånget 2023-04-09 | ||
turvallisuusmessut2021.fi | Utgånget 2023-04-09 | ||
turvallisuustapahtuma.fi | Inga DNS-poster hittades | 2024-09-27 | |
valomessut.fi | http://www.valomessut.fi/ | 2027-03-30 | |
valotapahtuma.fi | Utgånget 2024-03-30 | ||
varipinta.fi | Utgånget 2023-09-05 | ||
väripinta.fi | Utgånget 2023-09-01 | ||
venemessut.fi | http://vene.messukeskus.com/ | 2024-09-04 | |
vihertek.fi | Utgånget 2023-11-04 | ||
viiniexpo.fi | Utgånget 2023-09-04 | ||
viiniruoka.fi | http://www.viiniruoka.fi/ | 2025-04-28 | |
visitmatka.fi | Inga DNS-poster hittades | 2024-08-31 | |
winterexpo.fi | Utgånget 2023-10-17 | ||
woodexpo.fi | Utgånget 2023-11-18 | ||
ymparistomessut.fi | Utgånget 2023-09-05 | ||
ympäristömessut.fi | Utgånget 2023-09-01 | ||
ymparistotekniikkamessut.fi | http://www.ymparistotekniikkamessut.fi/ | 2024-06-06 | |
ympäristötekniikkamessut.fi | https://messukeskus.com/wp-signup.php?new=www.xn--ympristtek... | 2024-06-06 | |
yritys2017.fi | Utgånget 2021-02-03 | ||
yritys2018.fi | Inga DNS-poster hittades | 2027-01-26 |