terveysmessut.fi
Detaljer
Källa: Finlands transport- och kommunikationsbyrå (Traficom) och Internet Assigned Numbers Authority (IANA)Status | Registered |
Hållare | Messuaukio 1, Finland |
Beviljningsdatum | 2003-09-04 |
Sista giltighetsdatum | 2024-09-04 |
Registrator | Louhi Net Oy 00520 Helsinki |
Namnservrar Se DNS-avsnittet för detaljer | dns1.louhi.net dns2.louhi.net dns3.louhi.fi |
Är DNSSec i bruk | No |
IANA detaljer för suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP
Källa: Faktisk webbsida - Tidsstämpel: 2022-09-19 01:43VARNING: Observera att platsen kan vara helt fel om servern använder t.ex. omvänd proxy som Cloudflare
Server IP not valid or missing details in database. Map not shown
Word cloud för terveysmessut.fi
Tyvärr, inte tillräckligt med data för att analysera ett ordmoln för denna webbplats just nu
Webbsida information för terveysmessut.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-08-23 10:51Header data & Metataggar | |
Öppna graf (OG) metataggar | Att använda Open Graph-taggar rekommenderas starkt för sökmotoroptimering (SEO) |
Twitter-kort | Att använda Twitter-taggar rekommenderas starkt för sökmotoroptimering (SEO) |
Cascading Style Sheets (CSS) (CSS) | |
Länkar till sociala medier (SOME) | Att ha innehåll i sociala medier rekommenderas starkt för sökmotoroptimering (SEO) |
JavaScript-bibliotek |
Cookie-data för terveysmessut.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-08-23 10:51Antal kakor: 27
Cookie-domän | Cookievärden |
---|---|
doubleclick.net | Cookie name: test_cookie Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 29 bitgrupper |
fonts.net | Cookie name: __cf_bm Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 152 bitgrupper |
hubspot.com | Cookie name: __cf_bm Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 152 bitgrupper |
iloveme.messukeskus.com | Cookie name: _gat_UA-11620821-8 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 19 bitgrupper |
iloveme.messukeskus.com | Cookie name: _hjIncludedInSessionSample Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 27 bitgrupper |
iloveme.messukeskus.com | Cookie name: _gid Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 31 bitgrupper |
iloveme.messukeskus.com | Cookie name: _ga Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 30 bitgrupper |
iloveme.messukeskus.com | Cookie name: _hjIncludedInPageviewSample Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 28 bitgrupper |
messukeskus.com | Cookie name: _hjSession_417628 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 133 bitgrupper |
messukeskus.com | Cookie name: __hssc Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 31 bitgrupper |
messukeskus.com | Cookie name: __hssrc Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 8 bitgrupper |
messukeskus.com | Cookie name: hubspotutk Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 42 bitgrupper |
messukeskus.com | Cookie name: __hstc Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 92 bitgrupper |
messukeskus.com | Cookie name: _hjAbsoluteSessionInProgress Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 29 bitgrupper |
messukeskus.com | Cookie name: _hjSessionUser_417628 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 137 bitgrupper |
messukeskus.com | Cookie name: _hjFirstSeen Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 13 bitgrupper |
messukeskus.com | Cookie name: _gcl_au Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 32 bitgrupper |
messukeskus.com | Cookie name: OptanonConsent Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 240 bitgrupper |
messukeskus.com | Cookie name: _gat_gtag_UA_11620821_12 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 25 bitgrupper |
messukeskus.com | Cookie name: _gat_UA-11620821-14 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 20 bitgrupper |
messukeskus.com | Cookie name: _dc_gtm_UA-11620821-8 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 22 bitgrupper |
messukeskus.com | Cookie name: _gid Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 31 bitgrupper |
messukeskus.com | Cookie name: _ga Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 30 bitgrupper |
vimeo.com | Cookie name: __cf_bm Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 152 bitgrupper |
vimeo.com | Cookie name: vuid Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 27 bitgrupper |
youtube.com | Cookie name: YSC Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 14 bitgrupper |
youtube.com | Cookie name: VISITOR_INFO1_LIVE Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 29 bitgrupper |
Skärmdump för terveysmessut.fi
DNS-poster för terveysmessut.fi
Källa: DNS-svar - Tidsstämpel: 2022-09-19 01:43A | terveysmessut.fi 188.117.27.178 (Time to Live: 3600) |
MX | terveysmessut.fi (Time to Live: 3600) |
NS | dns3.louhi.fi
|
SOA | terveysmessut.fi dns1.louhi.net (Time to Live: 3600) hostmaster.louhi.net |
Whois rekordhistoria för terveysmessut.fi
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Visar senaste max 5 upptäckte förändringar i posterna. Ändringar markeras
Datum | 2020-05-16 | 2021-01-19 | 2021-05-16 | 2022-05-13 | 2023-05-13 |
---|---|---|---|---|---|
Name | terveysmessut.fi | terveysmessut.fi | terveysmessut.fi | terveysmessut.fi | terveysmessut.fi |
State | Registered | Registered | Registered | Registered | Registered |
Holder | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta |
Address | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2003-09-04T19:42:53 | 2003-09-04T19:42:53 | 2003-09-04T19:42:53 | 2003-09-04T19:42:53 | 2003-09-04T19:42:53 |
Registrar | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy |
PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
PostalCode | 00520 | 00520 | 00520 | 00520 | 00520 |
NameServer1 | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net |
NameServer2 | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net |
NameServer3 | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi |
PhoneNumber | +358404503250 | ||||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2021-09-04T19:42:53 | 2021-09-04T19:42:53 | 2022-09-04T19:42:53 | 2023-09-04T19:42:53 | 2024-09-04T19:42:53 |
DepartmentOrContactPerson |
Server svar för terveysmessut.fi
Källa: Webbserversvar - Tidsstämpel: 2022-09-19 01:43Slutlig URL | |
HTTP-returkod | |
IP-adress | |
Serverhuvud | Server: Via: |
Certifikat | Inte tillgänglig Att använda certifikat rekommenderas starkt för sökmotoroptimering (SEO) Om din webbplats har ett certifikat och du fortfarande ser denna varning betyder det att din webbserver inte är konfigurerad korrekt för att omdirigera trafik till en https-adress |
Begagnade tekniker på terveysmessut.fi
Källa: Webbsideanalys - Tidsstämpel: 2022-09-19 01:43Senaste recensionen | 2022-09-19 01:43 |
Sidspråk (från rubrik) | (Detta är ofta falskt!) |
Technologies |
Kända underdomäner för terveysmessut.fi
Källa: Sökmotorer och DNS-poster (MEDDELANDE: De flesta kanske inte kan nås (internt / DMZ / föråldrat)). Visar max rader 700Antal hittade underdomäner: 1
Subdomain | IP-adress |
---|---|
www.terveysmessut.fi | 188.117.27.178 |
Webbhotellleverantörer
Källa: Alla giltiga företagswebbplatser med innehåll (se tabellen nedan)
Domäner som ägs av samma ägare (nuvarande och tidigare)
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Antal domäner: 284
Domän namn | Slutlig URL (när sist testades) | Länkar | Sista giltighet |
---|---|---|---|
100ideaakevaaseen.fi | Utgånget 2023-01-27 | ||
55plus.fi | Inga DNS-poster hittades | 2025-02-09 | |
agriexpo.fi | Utgånget 2023-11-23 | ||
agrikone.fi | Utgånget 2023-11-23 | ||
agrikonemessut.fi | Utgånget 2023-11-23 | ||
agrimessut.fi | Utgånget 2023-11-23 | ||
antiikkitapahtuma.fi | http://antiikki.messukeskus.com/ | 2024-11-27 | |
apconfinland.fi | Utgånget 2021-08-16 | ||
arenaexpo.fi | https://arena.messukeskus.com/ | 2024-06-14 | |
asujaremontoi.fi | Inga DNS-poster hittades | 2024-10-25 | |
atvmessut.fi | Utgånget 2023-03-29 | ||
auto2017.fi | Utgånget 2000-12-31 | ||
auto2019.fi | http://auto.messukeskus.com/ | 2026-02-08 | |
auto2020.fi | Utgånget 2024-02-08 | ||
auto2021.fi | Utgånget 2024-02-08 | ||
auto2022.fi | Utgånget 2024-02-08 | ||
autokorjaamomessut.fi | https://autokorjaamo.messukeskus.com/ | 2024-09-20 | |
automaatiomessut.fi | Utgånget 2023-09-20 | ||
auto-messut.fi | http://auto.messukeskus.com/ | 2025-01-26 | |
båtmässa.fi | Inga DNS-poster hittades | 2024-09-01 | |
beautyprocover.fi | http://iloveme.messukeskus.com/beauty-pro/ | 2025-05-03 | |
beautypromessut.fi | Inga DNS-poster hittades | 2024-12-01 | |
bioenergyexpo.fi | Utgånget 2023-11-18 | ||
bioproductsexpo.fi | Utgånget 2023-11-18 | ||
bisnespaivat.fi | Utgånget 2024-01-03 | ||
bisnespäivät.fi | https://messukeskus.com/wp-signup.php?new=www.xn--bisnespivt... | 2026-01-03 | |
bolearenaclub.fi | Inga DNS-poster hittades | 2025-05-11 | |
bolearena.fi | Inga DNS-poster hittades | 2025-05-11 | |
böle.fi | Inga DNS-poster hittades | 2025-05-11 | |
businesstravelforum.fi | https://matka.messukeskus.com/b2b/ | 2024-05-22 | |
caravanmessut.fi | https://caravan.messukeskus.com/ | 2024-09-20 | |
chembiofinland.fi | http://chembio.messukeskus.com/ | 2025-02-19 | |
congresscenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
congresscentre.fi | Utgånget 2023-09-05 | ||
conventioncenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
conventioncentre.fi | https://messukeskus.com/wp-signup.php?new=www.conventioncent... | 2027-06-13 | |
corefair.fi | Utgånget 2018-04-16 | ||
coremessut.fi | Utgånget 2018-04-16 | ||
digiexpo.fi | Utgånget 2024-02-19 | ||
educafair.fi | Inga DNS-poster hittades | 2024-10-28 | |
educamessut.fi | Inga DNS-poster hittades | 2025-04-07 | |
elainystavani.fi | Inga DNS-poster hittades | 2025-05-20 | |
eläinystäväni.fi | Inga DNS-poster hittades | 2025-05-20 | |
elmamessut.fi | https://elma.messukeskus.com/ | 2024-09-05 | |
eltekmessut.fi | Utgånget 2023-09-04 | ||
emessukeskus.fi | http://www.emessukeskus.fi/ | 2025-03-27 | |
enviroexpo.fi | Utgånget 2024-01-29 | ||
facetoface.fi | Utgånget 2023-09-07 | ||
fairnet.fi | Utgånget 2023-09-04 | ||
fillarimessut.fi | https://goexpo.messukeskus.com/ | 2024-09-05 | |
finlandsmassa.fi | Utgånget 2023-09-04 | ||
finlandsmässa.fi | Utgånget 2023-09-01 | ||
finnbuild.fi | Inga DNS-poster hittades | 2024-09-04 | |
finnexpo.fi | Utgånget 2023-08-31 | ||
finnishdentalexhibition.fi | Inga DNS-poster hittades | 2024-11-17 | |
finnishfaircorporation.fi | https://messukeskus.com/wp-signup.php?new=www.finnishfaircor... | 2024-09-04 | |
finnsec.fi | http://www.finnsec.fi/ | 2024-09-04 | |
foodtechelsinki.fi | https://pfsptec.messukeskus.com/ | 2025-04-07 | |
formakevat.fi | Utgånget 2023-09-03 | ||
formakevät.fi | Utgånget 2023-09-03 | ||
formasyksy.fi | Utgånget 2023-09-03 | ||
funexpo.fi | http://www.funexpo.fi/ | 2024-09-28 | |
gamexpo.fi | Utgånget 2023-11-17 | ||
gastro.fi | Inga DNS-poster hittades | 2024-09-04 | |
gastrohelsinki.fi | Inga DNS-poster hittades | 2025-03-20 | |
gastropro.fi | https://gastro.messukeskus.com/ | 2024-11-01 | |
globalworkshop.fi | https://matka.messukeskus.com/ | 2024-10-25 | |
goexpo.fi | https://goexpo.messukeskus.com/ | 2025-12-04 | |
goexpohorse.fi | Utgånget 2023-12-06 | ||
goexpowinter.fi | Utgånget 2023-10-17 | ||
golfexpo.fi | Utgånget 2024-03-05 | ||
golfmessut.fi | https://golfmessut.fi/ | 2024-09-05 | |
graftec.fi | Utgånget 2024-04-22 | ||
growthhelsinki.fi | Utgånget 2023-02-07 | ||
gswpro.fi | Utgånget 2000-12-31 | ||
habitare.fi | Inga DNS-poster hittades | 2024-08-31 | |
habitarepro.fi | http://www.habitarepro.fi/ | 2024-09-22 | |
hammalääkäripäivätnäyttely.fi | Utgånget 2018-11-15 | ||
hammaslaakaripaivatnayttely.fi | Inga DNS-poster hittades | 2024-11-15 | |
hammaslääkäripäivätnäyttely.fi | https://hammaslaakaripaivat.messukeskus.com/ | 2024-11-25 | |
helsingforsbokmassa.fi | https://kirjamessut.messukeskus.com/?lang=sv | 2024-09-05 | |
helsingforsbokmässa.fi | https://messukeskus.com/wp-signup.php?new=www.xn--helsingfor... | 2024-09-01 | |
helsingforsmasscentrum.fi | Inga DNS-poster hittades | 2024-09-04 | |
helsingforsmässcentrum.fi | Utgånget 2019-09-01 | ||
helsingineramessut.fi | Inga DNS-poster hittades | 2025-04-19 | |
helsinginerämessut.fi | Inga DNS-poster hittades | 2025-04-19 | |
helsinginkirjamessut.fi | https://kirjamessut.messukeskus.com/ | 2024-09-05 | |
helsinginmessukeskus.fi | Inga DNS-poster hittades | 2024-08-31 | |
helsinginmessut.fi | http://www.wanhasatama.com/ | 2024-08-31 | |
helsinginmetsamessut.fi | Utgånget 2024-01-08 | ||
helsinginmetsämessut.fi | Utgånget 2024-01-08 | ||
helsinginmusiikkimessut.fi | Utgånget 2023-10-22 | ||
helsinkiboatshow.fi | Inga DNS-poster hittades | 2024-11-17 | |
helsinkibookfair.fi | Inga DNS-poster hittades | 2024-09-05 | |
helsinkicf.fi | Inga DNS-poster hittades | 2025-04-07 | |
helsinkiconventioncenter.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkiconventioncentre.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkiexhibitionandconventioncenter.fi | https://messukeskus.com/?lang=en | 2025-06-13 | |
helsinkiexhibitionandconventioncentre.fi | http://www.helsinkiexhibitionandconventioncentre.fi/ | 2025-06-13 | |
helsinkiexhibitioncenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
helsinkiexhibitioncentre.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkifaircentre.fi | http://messukeskus.com/?lang=en | 2024-09-04 | |
helsinkihorsefair.fi | http://www.helsinkihorsefair.fi/ | 2024-09-20 | |
highendhelsinki.fi | Utgånget 2024-01-18 | ||
highendhifi.fi | Utgånget 2024-01-16 | ||
himss.fi | Inga DNS-poster hittades | 2024-11-16 | |
horsefair.fi | Utgånget 2024-04-23 | ||
hpmessut.fi | http://www.hpmessut.fi/ | 2024-06-07 | |
hupicon.fi | Inga DNS-poster hittades | 2024-10-06 | |
iloveme.fi | http://iloveme.messukeskus.com/ | 2025-01-18 | |
infraexpo.fi | Utgånget 2024-01-31 | ||
jatevesiymparisto.fi | Inga DNS-poster hittades | 2024-09-04 | |
jätevesiympäristö.fi | http://www.xn--jtevesiymprist-5hbj42a.fi/ | 2024-09-04 | |
jewelandwatch.fi | Utgånget 2023-11-27 | ||
jobforum.fi | Utgånget 2023-10-22 | ||
jointec.fi | Utgånget 2024-04-24 | ||
jonnela.fi | Inga DNS-poster hittades | 2024-10-30 | |
jonnelaklubi.fi | Inga DNS-poster hittades | 2024-10-30 | |
julkinenateria.fi | https://ateria.messukeskus.com/ | 2024-11-25 | |
julkisivumessut.fi | Utgånget 2019-01-18 | ||
kadentaitotapahtuma.fi | Utgånget 2024-02-26 | ||
kädentaitotapahtuma.fi | Utgånget 2024-02-26 | ||
kalastusmessut.fi | Utgånget 2024-03-28 | ||
kauneusmessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
kevaanmerkit.fi | Utgånget 2024-03-30 | ||
keväänmerkit.fi | Utgånget 2024-03-30 | ||
kevatmessut.fi | http://www.kevatmessut.fi/ | 2025-01-08 | |
kevätmessut.fi | http://www.xn--kevtmessut-s5a.fi/ | 2025-01-08 | |
kevatpuutarha.fi | http://kevatmessut.messukeskus.com/ | 2024-09-04 | |
kiinteistoklusteri.fi | Utgånget 2024-03-29 | ||
kiinteistöklusteri.fi | Utgånget 2024-03-29 | ||
kiinteistomessut.fi | http://www.kiinteistomessut.fi/ | 2024-09-20 | |
kiinteistömessut.fi | Inga DNS-poster hittades | 2024-09-01 | |
kiinteistoplusturvallisuus.fi | Utgånget 2024-03-05 | ||
kiinteistöplusturvallisuus.fi | Utgånget 2024-03-05 | ||
kokoustamo.fi | Utgånget 2023-09-25 | ||
korjausjarakentaminen.fi | Utgånget 2023-09-07 | ||
korjausrakentaminen2018.fi | Utgånget 2023-10-04 | ||
korujakello.fi | Utgånget 2023-11-27 | ||
korujakellomessut.fi | Utgånget 2023-11-27 | ||
kuljetuslogistiikka.fi | Utgånget 2023-09-05 | ||
kutsutapahtumaan.fi | Inga DNS-poster hittades | 2024-10-25 | |
laakaripaivatnayttely.fi | https://laakaripaivat.messukeskus.com/ | 2024-09-20 | |
lääkäripäivätnäyttely.fi | Inga DNS-poster hittades | 2025-09-01 | |
lahiruokaluomu.fi | https://lahiruokajaluomu.messukeskus.com/ | 2024-09-21 | |
lähiruokaluomu.fi | https://kevatmessut.messukeskus.com/ | 2024-09-21 | |
lapsimessut.fi | https://lapsimessut.messukeskus.com/ | 2024-09-05 | |
lautasella.fi | Inga DNS-poster hittades | 2025-06-08 | |
lemmikkitapahtuma.fi | Inga DNS-poster hittades | 2024-12-16 | |
liikelahjamessut.fi | Utgånget 2019-10-30 | ||
liikelahjatmessut.fi | Utgånget 2019-10-30 | ||
logistiikkakuljetus.fi | Utgånget 2023-09-05 | ||
maatalouskonemessut.fi | https://maatalouskone.messukeskus.com/ | 2024-11-23 | |
maintec.fi | Utgånget 2018-04-22 | ||
manufacturingmaterials.fi | Utgånget 2023-10-30 | ||
markkinoinninviikko.fi | Utgånget 2024-03-09 | ||
matkahuutokauppa.fi | Utgånget 2019-12-13 | ||
matkailupalkinto.fi | Utgånget 2018-11-30 | ||
matkamessut.fi | Inga DNS-poster hittades | 2024-09-05 | |
matkapro.fi | Inga DNS-poster hittades | 2024-11-20 | |
maxpo.fi | http://www.maxpo.fi/ | 2024-09-04 | |
mecatec.fi | Utgånget 2023-08-31 | ||
meetfinland.fi | Inga DNS-poster hittades | 2024-09-28 | |
meidanviikonloppu.fi | Utgånget 2024-02-18 | ||
meidänviikonloppu.fi | Utgånget 2024-02-18 | ||
mesoaja.fi | http://www.mesoaja.fi/ | 2024-07-31 | |
messuhelmi.fi | Utgånget 2018-05-29 | ||
messukeskus100.fi | Utgånget 2023-11-20 | ||
messukeskushelsinki.fi | Inga DNS-poster hittades | 2024-10-10 | |
messukirppis.fi | Utgånget 2019-02-06 | ||
messuklubi.fi | Inga DNS-poster hittades | 2024-09-18 | |
messukutsu.fi | Inga DNS-poster hittades | 2024-05-22 | |
messumedia.fi | http://www.messumedia.fi/ | 2024-09-04 | |
messuparkki.fi | Inga DNS-poster hittades | 2025-05-29 | |
messut100.fi | Inga DNS-poster hittades | 2025-12-13 | |
messutapahtumat.fi | Inga DNS-poster hittades | 2024-09-20 | |
messuvalmennus.fi | Inga DNS-poster hittades | 2025-01-14 | |
metsamessut.fi | https://metsa.messukeskus.com/ | 2025-05-16 | |
metsämessut.fi | Inga DNS-poster hittades | 2024-05-16 | |
metsastysmessut.fi | Utgånget 2024-04-22 | ||
metsästysmessut.fi | Utgånget 2019-04-22 | ||
model-expo.fi | Utgånget 2023-10-14 | ||
modelexpo.fi | Utgånget 2023-10-14 | ||
moottorikelkkamessut.fi | Utgånget 2024-03-29 | ||
moottoripyoranayttely.fi | Utgånget 2024-02-19 | ||
moottoripyöränäyttely.fi | Inga DNS-poster hittades | 2024-09-01 | |
motokuume.fi | http://www.motokuume.fi/ | 2024-12-04 | |
motokuumemittari.fi | Utgånget 2024-01-21 | ||
mp-messut.fi | Inga DNS-poster hittades | 2024-09-29 | |
mpmessut.fi | http://mp.messukeskus.com/ | 2025-02-21 | |
mp-nayttely.fi | http://www.mp-nayttely.fi/ | 2025-02-19 | |
mprock.fi | Utgånget 2023-06-21 | ||
mpstars.fi | Utgånget 2023-11-02 | ||
muotimessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
nayttely.fi | Utgånget 2023-09-05 | ||
nbe.fi | Utgånget 2023-09-11 | ||
nordictravelfair.fi | http://matka.messukeskus.com/?lang=en | 2024-10-06 | |
oispatalvi.fi | http://www.oispatalvi.fi/ | 2024-09-14 | |
omakotimessut.fi | http://kevatmessut.messukeskus.com/ | 2024-09-20 | |
omamokki.fi | Inga DNS-poster hittades | 2024-09-04 | |
omamökki.fi | Inga DNS-poster hittades | 2024-09-01 | |
omapiha.fi | Inga DNS-poster hittades | 2024-09-04 | |
onseala.fi | Inga DNS-poster hittades | 2025-03-21 | |
outdoorexpo.fi | http://www.outdoorexpo.fi/ | 2024-12-16 | |
pactec.fi | Inga DNS-poster hittades | 2024-08-31 | |
petrolcircus.fi | Inga DNS-poster hittades | 2024-11-17 | |
plastexpo.fi | Utgånget 2023-09-24 | ||
pomppulinnataivas.fi | Utgånget 2023-10-25 | ||
pranabeats.fi | Utgånget 2019-10-13 | ||
pratkakuume.fi | Utgånget 2018-06-08 | ||
promoexpo.fi | Utgånget 2023-11-21 | ||
pulpandbeyond.fi | Inga DNS-poster hittades | 2025-05-11 | |
pulpaper.fi | Inga DNS-poster hittades | 2024-09-04 | |
pwaexpo.fi | Utgånget 2021-04-27 | ||
pwa.fi | Utgånget 2024-04-27 | ||
reset16.fi | Utgånget 2020-01-29 | ||
reset17.fi | Utgånget 2019-08-18 | ||
reset2017.fi | Utgånget 2019-08-17 | ||
retkimessut.fi | Utgånget 2024-02-19 | ||
robtec.fi | Utgånget 2000-12-31 | ||
ruokamessuthelsinki.fi | Inga DNS-poster hittades | 2025-01-09 | |
sahko-electricity.fi | Inga DNS-poster hittades | 2025-03-25 | |
sähkö-electricity.fi | Inga DNS-poster hittades | 2025-03-25 | |
sahkoexpo.fi | http://www.sahkoexpo.fi/ | 2025-03-25 | |
sähköexpo.fi | Inga DNS-poster hittades | 2025-03-25 | |
sähkömessut.fi | Inga DNS-poster hittades | 2025-02-15 | |
sairaanhoitajapaivatnayttely.fi | Inga DNS-poster hittades | 2025-04-20 | |
sairaanhoitajapäivätnäyttely.fi | Inga DNS-poster hittades | 2025-04-20 | |
seatechelsinki.fi | Utgånget 2000-12-31 | ||
secd-day.fi | Inga DNS-poster hittades | 2025-02-19 | |
seonala.fi | Inga DNS-poster hittades | 2025-04-19 | |
showroomfair.fi | Utgånget 2023-11-23 | ||
signtec.fi | Utgånget 2024-01-29 | ||
sihteeriassistenttimessut.fi | Utgånget 2023-10-30 | ||
sihteeriassistenttipaivat.fi | Utgånget 2023-10-30 | ||
sihteeriassistenttipäivät.fi | Utgånget 2023-10-30 | ||
sijoittaja23.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja25.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja26.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja27.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittajamessut.fi | https://sijoittajamessut.messukeskus.com/ | 2025-01-08 | |
sisahuvipuisto.fi | Inga DNS-poster hittades | 2024-06-13 | |
sisustamessut.fi | https://kevatmessut.messukeskus.com/ | 2024-06-14 | |
sisustusmessut.fi | Utgånget 2024-03-28 | ||
sporttitaivas.fi | https://messukeskus.com/wp-signup.php?new=www.sporttitaivas.... | 2024-06-15 | |
studiamessut.fi | http://studia.messukeskus.com/ | 2024-10-29 | |
suomenmessut.fi | http://messukeskus.com/ | 2024-08-31 | |
suomenmetsamessut.fi | Inga DNS-poster hittades | 2025-07-03 | |
suomenmetsämessut.fi | Inga DNS-poster hittades | 2024-07-03 | |
suomenvideoviestinta.fi | http://www.suomenvideoviestinta.fi/ | 2024-08-24 | |
svv.fi | https://svv.fi/ | 2024-09-04 | |
tanssiviekoon.fi | Utgånget 2023-12-22 | ||
teknologia17.fi | Utgånget 2019-03-19 | ||
teknologia19.fi | Utgånget 2024-03-19 | ||
teknologia21.fi | https://teknologia.messukeskus.com/ | 2024-10-16 | |
teknologia22.fi | Inga DNS-poster hittades | 2024-09-28 | |
teknologia23.fi | Inga DNS-poster hittades | 2025-02-20 | |
teknologiatapahtuma.fi | Inga DNS-poster hittades | 2024-08-16 | |
tempaudu.fi | Inga DNS-poster hittades | 2024-08-14 | |
terveysmessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
terveytesimessut.fi | Inga DNS-poster hittades | 2024-06-08 | |
tooltec.fi | https://teknologia.messukeskus.com/ | 2026-05-08 | |
travelfair.fi | http://www.travelfair.fi/ | 2024-10-06 | |
tsigaboom.fi | https://tsigaboom.messukeskus.com/ | 2024-08-15 | |
turvallisuus2021.fi | Utgånget 2023-04-09 | ||
turvallisuusmessut2021.fi | Utgånget 2023-04-09 | ||
turvallisuustapahtuma.fi | Inga DNS-poster hittades | 2024-09-27 | |
valomessut.fi | http://www.valomessut.fi/ | 2027-03-30 | |
valotapahtuma.fi | Utgånget 2024-03-30 | ||
varipinta.fi | Utgånget 2023-09-05 | ||
väripinta.fi | Utgånget 2023-09-01 | ||
venemessut.fi | http://vene.messukeskus.com/ | 2024-09-04 | |
vihertek.fi | Utgånget 2023-11-04 | ||
viiniexpo.fi | Utgånget 2023-09-04 | ||
viiniruoka.fi | http://www.viiniruoka.fi/ | 2025-04-28 | |
visitmatka.fi | Inga DNS-poster hittades | 2024-08-31 | |
winterexpo.fi | Utgånget 2023-10-17 | ||
woodexpo.fi | Utgånget 2023-11-18 | ||
ymparistomessut.fi | Utgånget 2023-09-05 | ||
ympäristömessut.fi | Utgånget 2023-09-01 | ||
ymparistotekniikkamessut.fi | http://www.ymparistotekniikkamessut.fi/ | 2024-06-06 | |
ympäristötekniikkamessut.fi | https://messukeskus.com/wp-signup.php?new=www.xn--ympristtek... | 2024-06-06 | |
yritys2017.fi | Utgånget 2021-02-03 | ||
yritys2018.fi | Inga DNS-poster hittades | 2027-01-26 |