teknologia19.fi
Detaljer
Källa: Finlands transport- och kommunikationsbyrå (Traficom) och Internet Assigned Numbers Authority (IANA)Status | Validity expired |
Hållare | Messuaukio 1, Finland |
Beviljningsdatum | 2015-03-25 |
Sista giltighetsdatum | 2024-03-19 |
Registrator | Louhi Net Oy 00520 Helsinki |
Namnservrar Se DNS-avsnittet för detaljer | dns1.louhi.net dns2.louhi.net dns3.louhi.fi |
Är DNSSec i bruk | No |
IANA detaljer för suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP
Källa: Faktisk webbsida - Tidsstämpel: 2022-09-19 07:27VARNING: Observera att platsen kan vara helt fel om servern använder t.ex. omvänd proxy som Cloudflare
IP source | IP address | ASN block data | IP Geolocation |
---|---|---|---|
Användar-IP | 18.117.70.132 | Detta hämtas inte för tillfället | Country: United States (US) City: Postal code: Latitude: 37,751 Longitude: -97,822 Network: 18.116.0.0/14 |
Server-IP | Autonomous System (AS) #: 29422 BGP prefix: 188.117.0.0/18 Country Code: FI Registry: ripencc Allocated: 2009-06-11 Info: NBLNETWORKS-AS Nebula Oy, FI | Country: Finland (FI) State: Uusimaa (18) City: Helsinki Postal code: 00720 Latitude: 60,2448 Longitude: 24,9912 Network: 188.117.16.0/20 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud för teknologia19.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-09-19 07:27Lägga märke till: Diverse ord tas bort från molnet för att förbättra analysen
Webbsida information för teknologia19.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-02-25 16:06Header data & Metataggar | title Teknologia 3.–5.5.2022 | Messukeskus Helsinki robots index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1 viewport width=device-width, initial-scale=1.0, maximum-scale=2.0 generator WPML ver:4.4.12 stt:1,18; not_found emptyIE=edge,chrome=1. fi_FI. website. Teknologia 3.–5.5.2022 | Messukeskus Helsinki. Pohjoismaiden johtava teknologiatapahtuma Teknologia tarjoaa kohtaamisia, uutuuksia, innovaatioita, kiinnostavia puheenvuoroja, paneelikeskusteluita sekä tietoiskuja.. https://teknologia.messukeskus.com/. Teknologia 3.–5.5.2022. 2022-02-24T12:45:39+00:00. https://messukeskus.s3.eu-central-1.amazonaws.com/wp-content/uploads/sites/40/2021/06/30071805/Teknologia21FBevent1920x1080.jpg. 1920. 1080. description Pohjoismaiden johtava teknologiatapahtuma Teknologia tarjoaa kohtaamisia, uutuuksia, innovaatioita, kiinnostavia puheenvuoroja, paneelikeskusteluita sekä tietoiskuja. theme-color #ffffff msapplication-config https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/img/icons/browserconfig.xml msapplication-tilecolor #ffffff |
Öppna graf (OG) metataggar | og:url https://teknologia.messukeskus.com/ og:type website og:image https://messukeskus.s3.eu-central-1.amazonaws.com/wp-content/uploads/sites/40/2021/06/30071805/Teknologia21FBevent1920x1080.jpg og:title Teknologia 3.–5.5.2022 | Messukeskus Helsinki og:locale fi_FI og:site_name Teknologia 3.–5.5.2022 og:description Pohjoismaiden johtava teknologiatapahtuma Teknologia tarjoaa kohtaamisia, uutuuksia, innovaatioita, kiinnostavia puheenvuoroja, paneelikeskusteluita sekä tietoiskuja. og:image:width 1920 og:image:height 1080 |
Twitter-kort | twitter:card summary twitter:image https://messukeskus.s3.eu-central-1.amazonaws.com/wp-content/uploads/sites/40/2019/09/30112733/Teknologia19Twitter1500x500.jpg twitter:title Teknologia 19 twitter:description Teknologia 19. Messukeskus Helsinki 5.–7.11.2019 Pohjoismaiden johtava teknologia-tapahtuma |
Cascading Style Sheets (CSS) (CSS) | https://teknologia.messukeskus.com/wp-includes/css/dist/block-library/style.min.css https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/bsa.carousel.css //teknologia.messukeskus.com/wp-content/plugins/sitepress-multilingual-cms/templates/language-switchers/legacy-dropdown/style.min.css https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/fonts/fontello/css/animation.css https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/remodal/dist/remodal.css https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/dist/css/main.1641899936.css https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/style.css?v https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/chart.css https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/material-design.css https://use.fontawesome.com/releases/v5.0.6/css/all.css https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/ui-datapicker.css https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/user-panel.css https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/fonts/fontello/css/fontello.css?20181003-1 https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/animate.css https://api.tiles.mapbox.com/mapbox-gl-js/v0.53.1/mapbox-gl.css //fast.fonts.net/cssapi/14fe8344-4391-401a-8913-ec217785557d.css https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/all.css |
Länkar till sociala medier (SOME) | Youtube: http://www.youtube.com/suomenmessut Facebook: http://www.facebook.com/messukeskus Linkedin: https://www.linkedin.com/company/messukeskushelsinki Instagram: https://www.instagram.com/messukeskus/ Pinterest: https://fi.pinterest.com/messukeskus/ |
JavaScript-bibliotek | https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/remodal/dist/remodal.min.js https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/js/chart.js https://teknologia.messukeskus.com/wp-includes/js/thickbox/thickbox.js https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/velocity/velocity.min.js https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/sticky-kit/jquery.sticky-kit.min.js https://teknologia.messukeskus.com/wp-includes/js/imagesloaded.min.js https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/dist/js/myquery.1641899936.js https://teknologia.messukeskus.com/wp-includes/js/clipboard.min.js https://teknologia.messukeskus.com/wp-includes/js/dist/vendor/moment.min.js https://teknologia.messukeskus.com/wp-includes/js/underscore.min.js https://teknologia.messukeskus.com/wp-includes/js/shortcode.min.js https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/hammerjs/hammer.min.js https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/js/bsa.carousel.js https://cdn.cookielaw.org/langswitch/e574c5d1-f15f-4df9-8e85-6044a9e59ce4.js https://teknologia.messukeskus.com/wp-admin/js/media-upload.min.js https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/jquery-date-range-picker/jquery.daterangepicker.js https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/js/jquery.viewportchecker.js https://teknologia.messukeskus.com/wp-includes/js/jquery/ui/datepicker.min.js https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/perfect-scrollbar/js/perfect-scrollbar.jquery.min.js https://teknologia.messukeskus.com/wp-includes/js/masonry.min.js //teknologia.messukeskus.com/wp-content/plugins/sitepress-multilingual-cms/templates/language-switchers/legacy-dropdown/script.min.js https://ajax.googleapis.com/ajax/libs/jquery/1.11.3/jquery.min.js https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/js/script.js https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/slick.js/slick/slick.min.js https://teknologia.messukeskus.com/wp-includes/js/jquery/jquery.min.js https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/vegas/dist/vegas.min.js https://teknologia.messukeskus.com/wp-includes/js/jquery/ui/core.min.js https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/chart.js/chart.min.js https://teknologia.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/js/jquery.simplyscroll.js //cdnjs.cloudflare.com/ajax/libs/modernizr/2.8.3/modernizr.min.js https://teknologia.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/countup.js/dist/countup.min.js https://teknologia.messukeskus.com/wp-includes/js/jquery/jquery-migrate.min.js |
Cookie-data för teknologia19.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-02-25 16:06Antal kakor: 8
Cookie-domän | Cookievärden |
---|---|
ads.linkedin.com | Cookie name: lang Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 18 bitgrupper |
fonts.net | Cookie name: __cf_bm Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 152 bitgrupper |
linkedin.com | Cookie name: UserMatchHistory Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 94 bitgrupper |
linkedin.com | Cookie name: AnalyticsSyncHistory Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 106 bitgrupper |
messukeskus.com | Cookie name: _gcl_au Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 31 bitgrupper |
teknologia.messukeskus.com | Cookie name: advanced_ads_browser_width Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 30 bitgrupper |
vimeo.com | Cookie name: vuid Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 27 bitgrupper |
vimeo.com | Cookie name: __cf_bm Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 152 bitgrupper |
Skärmdump för teknologia19.fi
DNS-poster för teknologia19.fi
Källa: DNS-svar - Tidsstämpel: 2022-09-19 07:27A | teknologia19.fi 188.117.27.178 (Time to Live: 3600) |
MX | teknologia19.fi (Time to Live: 3600) |
NS | dns1.louhi.net
|
SOA | teknologia19.fi dns1.louhi.net (Time to Live: 3600) hostmaster.louhi.net |
Whois rekordhistoria för teknologia19.fi
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Visar senaste max 5 upptäckte förändringar i posterna. Ändringar markeras
Datum | 2020-07-19 | 2021-01-19 | 2021-07-31 | 2022-07-22 | 2024-03-22 |
---|---|---|---|---|---|
Name | teknologia19.fi | teknologia19.fi | teknologia19.fi | teknologia19.fi | teknologia19.fi |
State | Registered | Registered | Registered | Registered | Validity expired |
Holder | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta |
Address | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2015-03-25T13:14:02 | 2015-03-25T13:14:02 | 2015-03-25T13:14:02 | 2015-03-25T13:14:02 | 2015-03-25T13:14:02 |
Registrar | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy |
PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
PostalCode | 00520 | 00520 | 00520 | 00520 | 00520 |
NameServer1 | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net |
NameServer2 | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net |
NameServer3 | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi |
PhoneNumber | +358404503250 | ||||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2022-03-19T15:43:31 | 2022-03-19T15:43:31 | 2023-03-19T15:43:31 | 2024-03-19T15:43:31 | 2024-03-19T15:43:31 |
DepartmentOrContactPerson |
Server svar för teknologia19.fi
Källa: Webbserversvar - Tidsstämpel: 2022-09-19 07:27Slutlig URL | https://teknologia.messukeskus.com/ |
HTTP-returkod | HTTP/1.1 200 OK |
IP-adress | 188.117.27.178 Autonomous System (AS) #: 29422 BGP prefix: 188.117.0.0/18 Country Code: Finland (FI) Registry: ripencc Allocated: 2009-06-11 Info: NBLNETWORKS-AS Nebula Oy, FI |
Serverhuvud | Server: Via: 1.1 varnish (Varnish/6.4) |
Certifikat | Issued By: DigiCert Inc Issuer details: O=DigiCert Inc, United States (US) Issuer details: CN=DigiCert TLS RSA SHA256 2020 CA1 Version: 2 Algorithm: RSA-SHA256 Issued On: 2022-02-28 00:00:00 Expires On: 2023-04-01 00:00:00 |
Certifikatämne | Country (C): FI Location (L): Helsinki Organization (O): Suomen Messut Oyj Common Name (CN): *.messukeskus.com |
Certifikat alternativa namn | *.messukeskus.com messukeskus.com |
Begagnade tekniker på teknologia19.fi
Källa: Webbsideanalys - Tidsstämpel: 2022-09-19 07:27Senaste recensionen | 2022-09-19 07:27 |
Sidspråk (från rubrik) | (Detta är ofta falskt!) |
Technologies |
Kända underdomäner för teknologia19.fi
Källa: Sökmotorer och DNS-poster (MEDDELANDE: De flesta kanske inte kan nås (internt / DMZ / föråldrat)). Visar max rader 700Antal hittade underdomäner: 1
Subdomain | IP-adress |
---|---|
www.teknologia19.fi | 188.117.27.178 |
Webbhotellleverantörer
Källa: Alla giltiga företagswebbplatser med innehåll (se tabellen nedan)
Domäner som ägs av samma ägare (nuvarande och tidigare)
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Antal domäner: 284
Domän namn | Slutlig URL (när sist testades) | Länkar | Sista giltighet |
---|---|---|---|
100ideaakevaaseen.fi | Utgånget 2023-01-27 | ||
55plus.fi | Inga DNS-poster hittades | 2025-02-09 | |
agriexpo.fi | Utgånget 2023-11-23 | ||
agrikone.fi | Utgånget 2023-11-23 | ||
agrikonemessut.fi | Utgånget 2023-11-23 | ||
agrimessut.fi | Utgånget 2023-11-23 | ||
antiikkitapahtuma.fi | http://antiikki.messukeskus.com/ | 2024-11-27 | |
apconfinland.fi | Utgånget 2021-08-16 | ||
arenaexpo.fi | https://arena.messukeskus.com/ | 2024-06-14 | |
asujaremontoi.fi | Inga DNS-poster hittades | 2024-10-25 | |
atvmessut.fi | Utgånget 2023-03-29 | ||
auto2017.fi | Utgånget 2000-12-31 | ||
auto2019.fi | http://auto.messukeskus.com/ | 2026-02-08 | |
auto2020.fi | Utgånget 2024-02-08 | ||
auto2021.fi | Utgånget 2024-02-08 | ||
auto2022.fi | Utgånget 2024-02-08 | ||
autokorjaamomessut.fi | https://autokorjaamo.messukeskus.com/ | 2024-09-20 | |
automaatiomessut.fi | Utgånget 2023-09-20 | ||
auto-messut.fi | http://auto.messukeskus.com/ | 2025-01-26 | |
båtmässa.fi | Inga DNS-poster hittades | 2024-09-01 | |
beautyprocover.fi | http://iloveme.messukeskus.com/beauty-pro/ | 2025-05-03 | |
beautypromessut.fi | Inga DNS-poster hittades | 2024-12-01 | |
bioenergyexpo.fi | Utgånget 2023-11-18 | ||
bioproductsexpo.fi | Utgånget 2023-11-18 | ||
bisnespaivat.fi | Utgånget 2024-01-03 | ||
bisnespäivät.fi | https://messukeskus.com/wp-signup.php?new=www.xn--bisnespivt... | 2026-01-03 | |
bolearenaclub.fi | Inga DNS-poster hittades | 2025-05-11 | |
bolearena.fi | Inga DNS-poster hittades | 2025-05-11 | |
böle.fi | Inga DNS-poster hittades | 2025-05-11 | |
businesstravelforum.fi | https://matka.messukeskus.com/b2b/ | 2024-05-22 | |
caravanmessut.fi | https://caravan.messukeskus.com/ | 2024-09-20 | |
chembiofinland.fi | http://chembio.messukeskus.com/ | 2025-02-19 | |
congresscenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
congresscentre.fi | Utgånget 2023-09-05 | ||
conventioncenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
conventioncentre.fi | https://messukeskus.com/wp-signup.php?new=www.conventioncent... | 2027-06-13 | |
corefair.fi | Utgånget 2018-04-16 | ||
coremessut.fi | Utgånget 2018-04-16 | ||
digiexpo.fi | Utgånget 2024-02-19 | ||
educafair.fi | Inga DNS-poster hittades | 2024-10-28 | |
educamessut.fi | Inga DNS-poster hittades | 2025-04-07 | |
elainystavani.fi | Inga DNS-poster hittades | 2025-05-20 | |
eläinystäväni.fi | Inga DNS-poster hittades | 2025-05-20 | |
elmamessut.fi | https://elma.messukeskus.com/ | 2024-09-05 | |
eltekmessut.fi | Utgånget 2023-09-04 | ||
emessukeskus.fi | http://www.emessukeskus.fi/ | 2025-03-27 | |
enviroexpo.fi | Utgånget 2024-01-29 | ||
facetoface.fi | Utgånget 2023-09-07 | ||
fairnet.fi | Utgånget 2023-09-04 | ||
fillarimessut.fi | https://goexpo.messukeskus.com/ | 2024-09-05 | |
finlandsmassa.fi | Utgånget 2023-09-04 | ||
finlandsmässa.fi | Utgånget 2023-09-01 | ||
finnbuild.fi | Inga DNS-poster hittades | 2024-09-04 | |
finnexpo.fi | Utgånget 2023-08-31 | ||
finnishdentalexhibition.fi | Inga DNS-poster hittades | 2024-11-17 | |
finnishfaircorporation.fi | https://messukeskus.com/wp-signup.php?new=www.finnishfaircor... | 2024-09-04 | |
finnsec.fi | http://www.finnsec.fi/ | 2024-09-04 | |
foodtechelsinki.fi | https://pfsptec.messukeskus.com/ | 2025-04-07 | |
formakevat.fi | Utgånget 2023-09-03 | ||
formakevät.fi | Utgånget 2023-09-03 | ||
formasyksy.fi | Utgånget 2023-09-03 | ||
funexpo.fi | http://www.funexpo.fi/ | 2024-09-28 | |
gamexpo.fi | Utgånget 2023-11-17 | ||
gastro.fi | Inga DNS-poster hittades | 2024-09-04 | |
gastrohelsinki.fi | Inga DNS-poster hittades | 2025-03-20 | |
gastropro.fi | https://gastro.messukeskus.com/ | 2024-11-01 | |
globalworkshop.fi | https://matka.messukeskus.com/ | 2024-10-25 | |
goexpo.fi | https://goexpo.messukeskus.com/ | 2025-12-04 | |
goexpohorse.fi | Utgånget 2023-12-06 | ||
goexpowinter.fi | Utgånget 2023-10-17 | ||
golfexpo.fi | Utgånget 2024-03-05 | ||
golfmessut.fi | https://golfmessut.fi/ | 2024-09-05 | |
graftec.fi | Utgånget 2024-04-22 | ||
growthhelsinki.fi | Utgånget 2023-02-07 | ||
gswpro.fi | Utgånget 2000-12-31 | ||
habitare.fi | Inga DNS-poster hittades | 2024-08-31 | |
habitarepro.fi | http://www.habitarepro.fi/ | 2024-09-22 | |
hammalääkäripäivätnäyttely.fi | Utgånget 2018-11-15 | ||
hammaslaakaripaivatnayttely.fi | Inga DNS-poster hittades | 2024-11-15 | |
hammaslääkäripäivätnäyttely.fi | https://hammaslaakaripaivat.messukeskus.com/ | 2024-11-25 | |
helsingforsbokmassa.fi | https://kirjamessut.messukeskus.com/?lang=sv | 2024-09-05 | |
helsingforsbokmässa.fi | https://messukeskus.com/wp-signup.php?new=www.xn--helsingfor... | 2024-09-01 | |
helsingforsmasscentrum.fi | Inga DNS-poster hittades | 2024-09-04 | |
helsingforsmässcentrum.fi | Utgånget 2019-09-01 | ||
helsingineramessut.fi | Inga DNS-poster hittades | 2025-04-19 | |
helsinginerämessut.fi | Inga DNS-poster hittades | 2025-04-19 | |
helsinginkirjamessut.fi | https://kirjamessut.messukeskus.com/ | 2024-09-05 | |
helsinginmessukeskus.fi | Inga DNS-poster hittades | 2024-08-31 | |
helsinginmessut.fi | http://www.wanhasatama.com/ | 2024-08-31 | |
helsinginmetsamessut.fi | Utgånget 2024-01-08 | ||
helsinginmetsämessut.fi | Utgånget 2024-01-08 | ||
helsinginmusiikkimessut.fi | Utgånget 2023-10-22 | ||
helsinkiboatshow.fi | Inga DNS-poster hittades | 2024-11-17 | |
helsinkibookfair.fi | Inga DNS-poster hittades | 2024-09-05 | |
helsinkicf.fi | Inga DNS-poster hittades | 2025-04-07 | |
helsinkiconventioncenter.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkiconventioncentre.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkiexhibitionandconventioncenter.fi | https://messukeskus.com/?lang=en | 2025-06-13 | |
helsinkiexhibitionandconventioncentre.fi | http://www.helsinkiexhibitionandconventioncentre.fi/ | 2025-06-13 | |
helsinkiexhibitioncenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
helsinkiexhibitioncentre.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkifaircentre.fi | http://messukeskus.com/?lang=en | 2024-09-04 | |
helsinkihorsefair.fi | http://www.helsinkihorsefair.fi/ | 2024-09-20 | |
highendhelsinki.fi | Utgånget 2024-01-18 | ||
highendhifi.fi | Utgånget 2024-01-16 | ||
himss.fi | Inga DNS-poster hittades | 2024-11-16 | |
horsefair.fi | Utgånget 2024-04-23 | ||
hpmessut.fi | http://www.hpmessut.fi/ | 2024-06-07 | |
hupicon.fi | Inga DNS-poster hittades | 2024-10-06 | |
iloveme.fi | http://iloveme.messukeskus.com/ | 2025-01-18 | |
infraexpo.fi | Utgånget 2024-01-31 | ||
jatevesiymparisto.fi | Inga DNS-poster hittades | 2024-09-04 | |
jätevesiympäristö.fi | http://www.xn--jtevesiymprist-5hbj42a.fi/ | 2024-09-04 | |
jewelandwatch.fi | Utgånget 2023-11-27 | ||
jobforum.fi | Utgånget 2023-10-22 | ||
jointec.fi | Utgånget 2024-04-24 | ||
jonnela.fi | Inga DNS-poster hittades | 2024-10-30 | |
jonnelaklubi.fi | Inga DNS-poster hittades | 2024-10-30 | |
julkinenateria.fi | https://ateria.messukeskus.com/ | 2024-11-25 | |
julkisivumessut.fi | Utgånget 2019-01-18 | ||
kadentaitotapahtuma.fi | Utgånget 2024-02-26 | ||
kädentaitotapahtuma.fi | Utgånget 2024-02-26 | ||
kalastusmessut.fi | Utgånget 2024-03-28 | ||
kauneusmessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
kevaanmerkit.fi | Utgånget 2024-03-30 | ||
keväänmerkit.fi | Utgånget 2024-03-30 | ||
kevatmessut.fi | http://www.kevatmessut.fi/ | 2025-01-08 | |
kevätmessut.fi | http://www.xn--kevtmessut-s5a.fi/ | 2025-01-08 | |
kevatpuutarha.fi | http://kevatmessut.messukeskus.com/ | 2024-09-04 | |
kiinteistoklusteri.fi | Utgånget 2024-03-29 | ||
kiinteistöklusteri.fi | Utgånget 2024-03-29 | ||
kiinteistomessut.fi | http://www.kiinteistomessut.fi/ | 2024-09-20 | |
kiinteistömessut.fi | Inga DNS-poster hittades | 2024-09-01 | |
kiinteistoplusturvallisuus.fi | Utgånget 2024-03-05 | ||
kiinteistöplusturvallisuus.fi | Utgånget 2024-03-05 | ||
kokoustamo.fi | Utgånget 2023-09-25 | ||
korjausjarakentaminen.fi | Utgånget 2023-09-07 | ||
korjausrakentaminen2018.fi | Utgånget 2023-10-04 | ||
korujakello.fi | Utgånget 2023-11-27 | ||
korujakellomessut.fi | Utgånget 2023-11-27 | ||
kuljetuslogistiikka.fi | Utgånget 2023-09-05 | ||
kutsutapahtumaan.fi | Inga DNS-poster hittades | 2024-10-25 | |
laakaripaivatnayttely.fi | https://laakaripaivat.messukeskus.com/ | 2024-09-20 | |
lääkäripäivätnäyttely.fi | Inga DNS-poster hittades | 2025-09-01 | |
lahiruokaluomu.fi | https://lahiruokajaluomu.messukeskus.com/ | 2024-09-21 | |
lähiruokaluomu.fi | https://kevatmessut.messukeskus.com/ | 2024-09-21 | |
lapsimessut.fi | https://lapsimessut.messukeskus.com/ | 2024-09-05 | |
lautasella.fi | Inga DNS-poster hittades | 2025-06-08 | |
lemmikkitapahtuma.fi | Inga DNS-poster hittades | 2024-12-16 | |
liikelahjamessut.fi | Utgånget 2019-10-30 | ||
liikelahjatmessut.fi | Utgånget 2019-10-30 | ||
logistiikkakuljetus.fi | Utgånget 2023-09-05 | ||
maatalouskonemessut.fi | https://maatalouskone.messukeskus.com/ | 2024-11-23 | |
maintec.fi | Utgånget 2018-04-22 | ||
manufacturingmaterials.fi | Utgånget 2023-10-30 | ||
markkinoinninviikko.fi | Utgånget 2024-03-09 | ||
matkahuutokauppa.fi | Utgånget 2019-12-13 | ||
matkailupalkinto.fi | Utgånget 2018-11-30 | ||
matkamessut.fi | Inga DNS-poster hittades | 2024-09-05 | |
matkapro.fi | Inga DNS-poster hittades | 2024-11-20 | |
maxpo.fi | http://www.maxpo.fi/ | 2024-09-04 | |
mecatec.fi | Utgånget 2023-08-31 | ||
meetfinland.fi | Inga DNS-poster hittades | 2024-09-28 | |
meidanviikonloppu.fi | Utgånget 2024-02-18 | ||
meidänviikonloppu.fi | Utgånget 2024-02-18 | ||
mesoaja.fi | http://www.mesoaja.fi/ | 2024-07-31 | |
messuhelmi.fi | Utgånget 2018-05-29 | ||
messukeskus100.fi | Utgånget 2023-11-20 | ||
messukeskushelsinki.fi | Inga DNS-poster hittades | 2024-10-10 | |
messukirppis.fi | Utgånget 2019-02-06 | ||
messuklubi.fi | Inga DNS-poster hittades | 2024-09-18 | |
messukutsu.fi | Inga DNS-poster hittades | 2024-05-22 | |
messumedia.fi | http://www.messumedia.fi/ | 2024-09-04 | |
messuparkki.fi | Inga DNS-poster hittades | 2025-05-29 | |
messut100.fi | Inga DNS-poster hittades | 2025-12-13 | |
messutapahtumat.fi | Inga DNS-poster hittades | 2024-09-20 | |
messuvalmennus.fi | Inga DNS-poster hittades | 2025-01-14 | |
metsamessut.fi | https://metsa.messukeskus.com/ | 2025-05-16 | |
metsämessut.fi | Inga DNS-poster hittades | 2024-05-16 | |
metsastysmessut.fi | Utgånget 2024-04-22 | ||
metsästysmessut.fi | Utgånget 2019-04-22 | ||
model-expo.fi | Utgånget 2023-10-14 | ||
modelexpo.fi | Utgånget 2023-10-14 | ||
moottorikelkkamessut.fi | Utgånget 2024-03-29 | ||
moottoripyoranayttely.fi | Utgånget 2024-02-19 | ||
moottoripyöränäyttely.fi | Inga DNS-poster hittades | 2024-09-01 | |
motokuume.fi | http://www.motokuume.fi/ | 2024-12-04 | |
motokuumemittari.fi | Utgånget 2024-01-21 | ||
mp-messut.fi | Inga DNS-poster hittades | 2024-09-29 | |
mpmessut.fi | http://mp.messukeskus.com/ | 2025-02-21 | |
mp-nayttely.fi | http://www.mp-nayttely.fi/ | 2025-02-19 | |
mprock.fi | Utgånget 2023-06-21 | ||
mpstars.fi | Utgånget 2023-11-02 | ||
muotimessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
nayttely.fi | Utgånget 2023-09-05 | ||
nbe.fi | Utgånget 2023-09-11 | ||
nordictravelfair.fi | http://matka.messukeskus.com/?lang=en | 2024-10-06 | |
oispatalvi.fi | http://www.oispatalvi.fi/ | 2024-09-14 | |
omakotimessut.fi | http://kevatmessut.messukeskus.com/ | 2024-09-20 | |
omamokki.fi | Inga DNS-poster hittades | 2024-09-04 | |
omamökki.fi | Inga DNS-poster hittades | 2024-09-01 | |
omapiha.fi | Inga DNS-poster hittades | 2024-09-04 | |
onseala.fi | Inga DNS-poster hittades | 2025-03-21 | |
outdoorexpo.fi | http://www.outdoorexpo.fi/ | 2024-12-16 | |
pactec.fi | Inga DNS-poster hittades | 2024-08-31 | |
petrolcircus.fi | Inga DNS-poster hittades | 2024-11-17 | |
plastexpo.fi | Utgånget 2023-09-24 | ||
pomppulinnataivas.fi | Utgånget 2023-10-25 | ||
pranabeats.fi | Utgånget 2019-10-13 | ||
pratkakuume.fi | Utgånget 2018-06-08 | ||
promoexpo.fi | Utgånget 2023-11-21 | ||
pulpandbeyond.fi | Inga DNS-poster hittades | 2025-05-11 | |
pulpaper.fi | Inga DNS-poster hittades | 2024-09-04 | |
pwaexpo.fi | Utgånget 2021-04-27 | ||
pwa.fi | 2024-04-27 | ||
reset16.fi | Utgånget 2020-01-29 | ||
reset17.fi | Utgånget 2019-08-18 | ||
reset2017.fi | Utgånget 2019-08-17 | ||
retkimessut.fi | Utgånget 2024-02-19 | ||
robtec.fi | Utgånget 2000-12-31 | ||
ruokamessuthelsinki.fi | Inga DNS-poster hittades | 2025-01-09 | |
sahko-electricity.fi | Inga DNS-poster hittades | 2025-03-25 | |
sähkö-electricity.fi | Inga DNS-poster hittades | 2025-03-25 | |
sahkoexpo.fi | http://www.sahkoexpo.fi/ | 2025-03-25 | |
sähköexpo.fi | Inga DNS-poster hittades | 2025-03-25 | |
sähkömessut.fi | Inga DNS-poster hittades | 2025-02-15 | |
sairaanhoitajapaivatnayttely.fi | Inga DNS-poster hittades | 2025-04-20 | |
sairaanhoitajapäivätnäyttely.fi | Inga DNS-poster hittades | 2025-04-20 | |
seatechelsinki.fi | Utgånget 2000-12-31 | ||
secd-day.fi | Inga DNS-poster hittades | 2025-02-19 | |
seonala.fi | Inga DNS-poster hittades | 2025-04-19 | |
showroomfair.fi | Utgånget 2023-11-23 | ||
signtec.fi | Utgånget 2024-01-29 | ||
sihteeriassistenttimessut.fi | Utgånget 2023-10-30 | ||
sihteeriassistenttipaivat.fi | Utgånget 2023-10-30 | ||
sihteeriassistenttipäivät.fi | Utgånget 2023-10-30 | ||
sijoittaja23.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja25.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja26.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja27.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittajamessut.fi | https://sijoittajamessut.messukeskus.com/ | 2025-01-08 | |
sisahuvipuisto.fi | Inga DNS-poster hittades | 2024-06-13 | |
sisustamessut.fi | https://kevatmessut.messukeskus.com/ | 2024-06-14 | |
sisustusmessut.fi | Utgånget 2024-03-28 | ||
sporttitaivas.fi | https://messukeskus.com/wp-signup.php?new=www.sporttitaivas.... | 2024-06-15 | |
studiamessut.fi | http://studia.messukeskus.com/ | 2024-10-29 | |
suomenmessut.fi | http://messukeskus.com/ | 2024-08-31 | |
suomenmetsamessut.fi | Inga DNS-poster hittades | 2025-07-03 | |
suomenmetsämessut.fi | Inga DNS-poster hittades | 2024-07-03 | |
suomenvideoviestinta.fi | http://www.suomenvideoviestinta.fi/ | 2024-08-24 | |
svv.fi | https://svv.fi/ | 2024-09-04 | |
tanssiviekoon.fi | Utgånget 2023-12-22 | ||
teknologia17.fi | Utgånget 2019-03-19 | ||
teknologia19.fi | Utgånget 2024-03-19 | ||
teknologia21.fi | https://teknologia.messukeskus.com/ | 2024-10-16 | |
teknologia22.fi | Inga DNS-poster hittades | 2024-09-28 | |
teknologia23.fi | Inga DNS-poster hittades | 2025-02-20 | |
teknologiatapahtuma.fi | Inga DNS-poster hittades | 2024-08-16 | |
tempaudu.fi | Inga DNS-poster hittades | 2024-08-14 | |
terveysmessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
terveytesimessut.fi | Inga DNS-poster hittades | 2024-06-08 | |
tooltec.fi | https://teknologia.messukeskus.com/ | 2026-05-08 | |
travelfair.fi | http://www.travelfair.fi/ | 2024-10-06 | |
tsigaboom.fi | https://tsigaboom.messukeskus.com/ | 2024-08-15 | |
turvallisuus2021.fi | Utgånget 2023-04-09 | ||
turvallisuusmessut2021.fi | Utgånget 2023-04-09 | ||
turvallisuustapahtuma.fi | Inga DNS-poster hittades | 2024-09-27 | |
valomessut.fi | http://www.valomessut.fi/ | 2027-03-30 | |
valotapahtuma.fi | Utgånget 2024-03-30 | ||
varipinta.fi | Utgånget 2023-09-05 | ||
väripinta.fi | Utgånget 2023-09-01 | ||
venemessut.fi | http://vene.messukeskus.com/ | 2024-09-04 | |
vihertek.fi | Utgånget 2023-11-04 | ||
viiniexpo.fi | Utgånget 2023-09-04 | ||
viiniruoka.fi | http://www.viiniruoka.fi/ | 2025-04-28 | |
visitmatka.fi | Inga DNS-poster hittades | 2024-08-31 | |
winterexpo.fi | Utgånget 2023-10-17 | ||
woodexpo.fi | Utgånget 2023-11-18 | ||
ymparistomessut.fi | Utgånget 2023-09-05 | ||
ympäristömessut.fi | Utgånget 2023-09-01 | ||
ymparistotekniikkamessut.fi | http://www.ymparistotekniikkamessut.fi/ | 2024-06-06 | |
ympäristötekniikkamessut.fi | https://messukeskus.com/wp-signup.php?new=www.xn--ympristtek... | 2024-06-06 | |
yritys2017.fi | Utgånget 2021-02-03 | ||
yritys2018.fi | Inga DNS-poster hittades | 2027-01-26 |