habitarepro.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)| State | Registered |
| Holder | Messuaukio 1, Finland |
| Grant Date | 2017-09-22 |
| Last Validity Date | 2024-09-22 |
| Registrar | Telia Finland Oyj 00520 Helsinki |
| Name Servers Please see DNS section for details | ns.nebula.fi ns2.nebula.fi |
| Is The DNSSec in Use | No |
| IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-10-31 19:10WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
| IP source | IP address | ASN block data | IP Geolocation |
|---|---|---|---|
| User IP | 3.14.70.203 | This is not retrieved for now | Country: United States (US) State: Ohio (OH) City: Columbus Postal code: 43215 Latitude: 39.9653 Longitude: -83.0235 Network: 3.14.0.0/15 |
| Server IP | Autonomous System (AS) #: 29422 BGP prefix: 188.117.0.0/18 Country Code: FI Registry: ripencc Allocated: 2009-06-11 Info: NBLNETWORKS-AS Nebula Oy, FI | Country: Finland (FI) State: Uusimaa (18) City: Helsinki Postal code: 00720 Latitude: 60.2448 Longitude: 24.9912 Network: 188.117.16.0/20 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud for habitarepro.fi
Sorry, not enough data to parse a word cloud for this site at this time
Web page details for habitarepro.fi
Source: Actual web page - Timestamp: 2022-11-30 14:03| Header data & Meta tags | |
| Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
| Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
| Cascading Style Sheets (CSS) (CSS) | |
| Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
| JavaScript libraries |
Cookie data for habitarepro.fi
Source: Actual web page - Timestamp: 2022-11-30 14:03Number of cookies: 13
| Cookie domain | Cookie values |
|---|---|
| ads.linkedin.com | Cookie name: lang Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 18 bytes |
| fonts.net | Cookie name: __cf_bm Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 152 bytes |
| habitare.messukeskus.com | Cookie name: advanced_ads_browser_width Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 30 bytes |
| habitare.messukeskus.com | Cookie name: _hjIncludedInSessionSample Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 27 bytes |
| habitare.messukeskus.com | Cookie name: _hjIncludedInPageviewSample Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 28 bytes |
| linkedin.com | Cookie name: UserMatchHistory Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 94 bytes |
| linkedin.com | Cookie name: AnalyticsSyncHistory Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 106 bytes |
| linkedin.com | Cookie name: lang Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 18 bytes |
| messukeskus.com | Cookie name: _gcl_au Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 32 bytes |
| messukeskus.com | Cookie name: _hjSessionUser_417628 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 137 bytes |
| messukeskus.com | Cookie name: _hjFirstSeen Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 13 bytes |
| messukeskus.com | Cookie name: _hjSession_417628 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 133 bytes |
| messukeskus.com | Cookie name: _hjAbsoluteSessionInProgress Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 29 bytes |
Screenshot for habitarepro.fi
Source: Actual web page - Timestamp: 2022-10-31 19:10
DNS records for habitarepro.fi
Source: DNS reponse - Timestamp: 2022-10-31 19:10| A | habitarepro.fi 188.117.27.178 (Time to Live: 7200) |
| NS | ns2.nebula.fi
|
| SOA | habitarepro.fi ns.nebula.fi (Time to Live: 7200) hostmaster.nebula.fi |
Whois record history for habitarepro.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
| Date | 2021-01-19 | 2021-09-16 | 2022-09-16 | 2023-09-16 | 2023-10-04 |
|---|---|---|---|---|---|
| Name | habitarepro.fi | habitarepro.fi | habitarepro.fi | habitarepro.fi | habitarepro.fi |
| State | Registered | Registered | Registered | Registered | Registered |
| Holder | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta |
| Address | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 |
| Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
| GrantDate | 2017-09-22T16:16:16.783 | 2017-09-22T16:16:16.783 | 2017-09-22T16:16:16.783 | 2017-09-22T16:16:16.783 | 2017-09-22T16:16:16.783 |
| Registrar | Telia Inmics-Nebula Oy | Telia Inmics-Nebula Oy | Telia Inmics-Nebula Oy | Telia Inmics-Nebula Oy | Telia Finland Oyj |
| PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
| PostalCode | 00520 | 00520 | 00520 | 00520 | 00520 |
| NameServer1 | ns.nebula.fi | ns.nebula.fi | ns.nebula.fi | ns.nebula.fi | ns.nebula.fi |
| NameServer2 | ns2.nebula.fi | ns2.nebula.fi | ns2.nebula.fi | ns2.nebula.fi | ns2.nebula.fi |
| PhoneNumber | |||||
| IsDNSSecInUse | no | no | no | no | no |
| OrganizationId | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 |
| AssociationType | Company | Company | Company | Company | Company |
| LastValidityDate | 2021-09-22T16:16:16.783 | 2022-09-22T16:16:16.783 | 2023-09-22T16:16:16.783 | 2024-09-22T16:16:16.783 | 2024-09-22T16:16:16.783 |
| DepartmentOrContactPerson |
Server response for habitarepro.fi
Source: Web server reponse - Timestamp: 2022-10-31 19:10| Final URL | http://www.habitarepro.fi/ |
| HTTP Return Code | HTTP/1.1 301 Moved Permanently |
| IP Address | 188.117.27.178 Autonomous System (AS) #: 29422 BGP prefix: 188.117.0.0/18 Country Code: Finland (FI) Registry: ripencc Allocated: 2009-06-11 Info: NBLNETWORKS-AS Nebula Oy, FI |
| Server Header | Server: Via: |
| Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on habitarepro.fi
Source: Web page analysis - Timestamp: 2022-10-31 19:10| Latest review | 2022-10-31 19:10 |
| Page language (from header) | en-US (This is often false!) |
| Technologies |  Elementor 3.8.0 (Landing Page Builders) (100% propable) Google Font API (Font Scripts) (100% propable) Nginx (Web ServersReverse Proxy) (100% propable) Swiper Slider (Miscellaneous) (100% propable) WP Rocket 3.11.0.5 (Cache Tools) (100% propable) WordPress 5.9.5 (CMSBlogs) (100% propable) Yoast SEO 19.9 (SEO) (100% propable) jQuery 3.6.5 (JavaScript Libraries) (100% propable) jQuery Migrate 3.3.2 (JavaScript Libraries) (100% propable) |
Known subdomains for habitarepro.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700Number of subdomains found: 1
| Subdomain | IP address |
|---|---|
| www.habitarepro.fi | 188.117.27.178 |
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 284
| Domain name | Final URL (when last tested) | Links | Last validity |
|---|---|---|---|
| 100ideaakevaaseen.fi | Expired 2023-01-27 | ||
| 55plus.fi | No DNS records found | 2025-02-09 | |
| agriexpo.fi | Expired 2023-11-23 | ||
| agrikone.fi | Expired 2023-11-23 | ||
| agrikonemessut.fi | Expired 2023-11-23 | ||
| agrimessut.fi | Expired 2023-11-23 | ||
| antiikkitapahtuma.fi | http://antiikki.messukeskus.com/ | 2024-11-27 | |
| apconfinland.fi | Expired 2021-08-16 | ||
| arenaexpo.fi | https://arena.messukeskus.com/ | 2024-06-14 | |
| asujaremontoi.fi | No DNS records found | 2024-10-25 | |
| atvmessut.fi | Expired 2023-03-29 | ||
| auto2017.fi | Expired 2000-12-31 | ||
| auto2019.fi | http://auto.messukeskus.com/ | 2026-02-08 | |
| auto2020.fi | Expired 2024-02-08 | ||
| auto2021.fi | Expired 2024-02-08 | ||
| auto2022.fi | Expired 2024-02-08 | ||
| autokorjaamomessut.fi | https://autokorjaamo.messukeskus.com/ | 2024-09-20 | |
| automaatiomessut.fi | Expired 2023-09-20 | ||
| auto-messut.fi | http://auto.messukeskus.com/ | 2025-01-26 | |
| båtmässa.fi | No DNS records found | 2024-09-01 | |
| beautyprocover.fi | http://iloveme.messukeskus.com/beauty-pro/ | 2025-05-03 | |
| beautypromessut.fi | No DNS records found | 2024-12-01 | |
| bioenergyexpo.fi | Expired 2023-11-18 | ||
| bioproductsexpo.fi | Expired 2023-11-18 | ||
| bisnespaivat.fi | Expired 2024-01-03 | ||
| bisnespäivät.fi | https://messukeskus.com/wp-signup.php?new=www.xn--bisnespivt... | 2026-01-03 | |
| bolearenaclub.fi | No DNS records found | 2025-05-11 | |
| bolearena.fi | No DNS records found | 2025-05-11 | |
| böle.fi | No DNS records found | 2025-05-11 | |
| businesstravelforum.fi | https://matka.messukeskus.com/b2b/ | 2024-05-22 | |
| caravanmessut.fi | https://caravan.messukeskus.com/ | 2024-09-20 | |
| chembiofinland.fi | http://chembio.messukeskus.com/ | 2025-02-19 | |
| congresscenter.fi | No DNS records found | 2024-06-13 | |
| congresscentre.fi | Expired 2023-09-05 | ||
| conventioncenter.fi | No DNS records found | 2024-06-13 | |
| conventioncentre.fi | https://messukeskus.com/wp-signup.php?new=www.conventioncent... | 2027-06-13 | |
| corefair.fi | Expired 2018-04-16 | ||
| coremessut.fi | Expired 2018-04-16 | ||
| digiexpo.fi | Expired 2024-02-19 | ||
| educafair.fi | No DNS records found | 2024-10-28 | |
| educamessut.fi | No DNS records found | 2025-04-07 | |
| elainystavani.fi | No DNS records found | 2025-05-20 | |
| eläinystäväni.fi | No DNS records found | 2025-05-20 | |
| elmamessut.fi | https://elma.messukeskus.com/ | 2024-09-05 | |
| eltekmessut.fi | Expired 2023-09-04 | ||
| emessukeskus.fi | http://www.emessukeskus.fi/ | 2025-03-27 | |
| enviroexpo.fi | Expired 2024-01-29 | ||
| facetoface.fi | Expired 2023-09-07 | ||
| fairnet.fi | Expired 2023-09-04 | ||
| fillarimessut.fi | https://goexpo.messukeskus.com/ | 2024-09-05 | |
| finlandsmassa.fi | Expired 2023-09-04 | ||
| finlandsmässa.fi | Expired 2023-09-01 | ||
| finnbuild.fi | No DNS records found | 2024-09-04 | |
| finnexpo.fi | Expired 2023-08-31 | ||
| finnishdentalexhibition.fi | No DNS records found | 2024-11-17 | |
| finnishfaircorporation.fi | https://messukeskus.com/wp-signup.php?new=www.finnishfaircor... | 2024-09-04 | |
| finnsec.fi | http://www.finnsec.fi/ | 2024-09-04 | |
| foodtechelsinki.fi | https://pfsptec.messukeskus.com/ | 2025-04-07 | |
| formakevat.fi | Expired 2023-09-03 | ||
| formakevät.fi | Expired 2023-09-03 | ||
| formasyksy.fi | Expired 2023-09-03 | ||
| funexpo.fi | http://www.funexpo.fi/ | 2024-09-28 | |
| gamexpo.fi | Expired 2023-11-17 | ||
| gastro.fi | No DNS records found | 2024-09-04 | |
| gastrohelsinki.fi | No DNS records found | 2025-03-20 | |
| gastropro.fi | https://gastro.messukeskus.com/ | 2024-11-01 | |
| globalworkshop.fi | https://matka.messukeskus.com/ | 2024-10-25 | |
| goexpo.fi | https://goexpo.messukeskus.com/ | 2025-12-04 | |
| goexpohorse.fi | Expired 2023-12-06 | ||
| goexpowinter.fi | Expired 2023-10-17 | ||
| golfexpo.fi | Expired 2024-03-05 | ||
| golfmessut.fi | https://golfmessut.fi/ | 2024-09-05 | |
| graftec.fi | Expired 2024-04-22 | ||
| growthhelsinki.fi | Expired 2023-02-07 | ||
| gswpro.fi | Expired 2000-12-31 | ||
| habitare.fi | No DNS records found | 2024-08-31 | |
| habitarepro.fi | http://www.habitarepro.fi/ | 2024-09-22 | |
| hammalääkäripäivätnäyttely.fi | Expired 2018-11-15 | ||
| hammaslaakaripaivatnayttely.fi | No DNS records found | 2024-11-15 | |
| hammaslääkäripäivätnäyttely.fi | https://hammaslaakaripaivat.messukeskus.com/ | 2024-11-25 | |
| helsingforsbokmassa.fi | https://kirjamessut.messukeskus.com/?lang=sv | 2024-09-05 | |
| helsingforsbokmässa.fi | https://messukeskus.com/wp-signup.php?new=www.xn--helsingfor... | 2024-09-01 | |
| helsingforsmasscentrum.fi | No DNS records found | 2024-09-04 | |
| helsingforsmässcentrum.fi | Expired 2019-09-01 | ||
| helsingineramessut.fi | No DNS records found | 2025-04-19 | |
| helsinginerämessut.fi | No DNS records found | 2025-04-19 | |
| helsinginkirjamessut.fi | https://kirjamessut.messukeskus.com/ | 2024-09-05 | |
| helsinginmessukeskus.fi | No DNS records found | 2024-08-31 | |
| helsinginmessut.fi | http://www.wanhasatama.com/ | 2024-08-31 | |
| helsinginmetsamessut.fi | Expired 2024-01-08 | ||
| helsinginmetsämessut.fi | Expired 2024-01-08 | ||
| helsinginmusiikkimessut.fi | Expired 2023-10-22 | ||
| helsinkiboatshow.fi | No DNS records found | 2024-11-17 | |
| helsinkibookfair.fi | No DNS records found | 2024-09-05 | |
| helsinkicf.fi | No DNS records found | 2025-04-07 | |
| helsinkiconventioncenter.fi | No DNS records found | 2025-06-13 | |
| helsinkiconventioncentre.fi | No DNS records found | 2025-06-13 | |
| helsinkiexhibitionandconventioncenter.fi | https://messukeskus.com/?lang=en | 2025-06-13 | |
| helsinkiexhibitionandconventioncentre.fi | http://www.helsinkiexhibitionandconventioncentre.fi/ | 2025-06-13 | |
| helsinkiexhibitioncenter.fi | No DNS records found | 2024-06-13 | |
| helsinkiexhibitioncentre.fi | No DNS records found | 2025-06-13 | |
| helsinkifaircentre.fi | http://messukeskus.com/?lang=en | 2024-09-04 | |
| helsinkihorsefair.fi | http://www.helsinkihorsefair.fi/ | 2024-09-20 | |
| highendhelsinki.fi | Expired 2024-01-18 | ||
| highendhifi.fi | Expired 2024-01-16 | ||
| himss.fi | No DNS records found | 2024-11-16 | |
| horsefair.fi | Expired 2024-04-23 | ||
| hpmessut.fi | http://www.hpmessut.fi/ | 2024-06-07 | |
| hupicon.fi | No DNS records found | 2024-10-06 | |
| iloveme.fi | http://iloveme.messukeskus.com/ | 2025-01-18 | |
| infraexpo.fi | Expired 2024-01-31 | ||
| jatevesiymparisto.fi | No DNS records found | 2024-09-04 | |
| jätevesiympäristö.fi | http://www.xn--jtevesiymprist-5hbj42a.fi/ | 2024-09-04 | |
| jewelandwatch.fi | Expired 2023-11-27 | ||
| jobforum.fi | Expired 2023-10-22 | ||
| jointec.fi | Expired 2024-04-24 | ||
| jonnela.fi | No DNS records found | 2024-10-30 | |
| jonnelaklubi.fi | No DNS records found | 2024-10-30 | |
| julkinenateria.fi | https://ateria.messukeskus.com/ | 2024-11-25 | |
| julkisivumessut.fi | Expired 2019-01-18 | ||
| kadentaitotapahtuma.fi | Expired 2024-02-26 | ||
| kädentaitotapahtuma.fi | Expired 2024-02-26 | ||
| kalastusmessut.fi | Expired 2024-03-28 | ||
| kauneusmessut.fi | No DNS records found | 2024-09-04 | |
| kevaanmerkit.fi | Expired 2024-03-30 | ||
| keväänmerkit.fi | Expired 2024-03-30 | ||
| kevatmessut.fi | http://www.kevatmessut.fi/ | 2025-01-08 | |
| kevätmessut.fi | http://www.xn--kevtmessut-s5a.fi/ | 2025-01-08 | |
| kevatpuutarha.fi | http://kevatmessut.messukeskus.com/ | 2024-09-04 | |
| kiinteistoklusteri.fi | Expired 2024-03-29 | ||
| kiinteistöklusteri.fi | Expired 2024-03-29 | ||
| kiinteistomessut.fi | http://www.kiinteistomessut.fi/ | 2024-09-20 | |
| kiinteistömessut.fi | No DNS records found | 2024-09-01 | |
| kiinteistoplusturvallisuus.fi | Expired 2024-03-05 | ||
| kiinteistöplusturvallisuus.fi | Expired 2024-03-05 | ||
| kokoustamo.fi | Expired 2023-09-25 | ||
| korjausjarakentaminen.fi | Expired 2023-09-07 | ||
| korjausrakentaminen2018.fi | Expired 2023-10-04 | ||
| korujakello.fi | Expired 2023-11-27 | ||
| korujakellomessut.fi | Expired 2023-11-27 | ||
| kuljetuslogistiikka.fi | Expired 2023-09-05 | ||
| kutsutapahtumaan.fi | No DNS records found | 2024-10-25 | |
| laakaripaivatnayttely.fi | https://laakaripaivat.messukeskus.com/ | 2024-09-20 | |
| lääkäripäivätnäyttely.fi | No DNS records found | 2025-09-01 | |
| lahiruokaluomu.fi | https://lahiruokajaluomu.messukeskus.com/ | 2024-09-21 | |
| lähiruokaluomu.fi | https://kevatmessut.messukeskus.com/ | 2024-09-21 | |
| lapsimessut.fi | https://lapsimessut.messukeskus.com/ | 2024-09-05 | |
| lautasella.fi | No DNS records found | 2025-06-08 | |
| lemmikkitapahtuma.fi | No DNS records found | 2024-12-16 | |
| liikelahjamessut.fi | Expired 2019-10-30 | ||
| liikelahjatmessut.fi | Expired 2019-10-30 | ||
| logistiikkakuljetus.fi | Expired 2023-09-05 | ||
| maatalouskonemessut.fi | https://maatalouskone.messukeskus.com/ | 2024-11-23 | |
| maintec.fi | Expired 2018-04-22 | ||
| manufacturingmaterials.fi | Expired 2023-10-30 | ||
| markkinoinninviikko.fi | Expired 2024-03-09 | ||
| matkahuutokauppa.fi | Expired 2019-12-13 | ||
| matkailupalkinto.fi | Expired 2018-11-30 | ||
| matkamessut.fi | No DNS records found | 2024-09-05 | |
| matkapro.fi | No DNS records found | 2024-11-20 | |
| maxpo.fi | http://www.maxpo.fi/ | 2024-09-04 | |
| mecatec.fi | Expired 2023-08-31 | ||
| meetfinland.fi | No DNS records found | 2024-09-28 | |
| meidanviikonloppu.fi | Expired 2024-02-18 | ||
| meidänviikonloppu.fi | Expired 2024-02-18 | ||
| mesoaja.fi | http://www.mesoaja.fi/ | 2024-07-31 | |
| messuhelmi.fi | Expired 2018-05-29 | ||
| messukeskus100.fi | Expired 2023-11-20 | ||
| messukeskushelsinki.fi | No DNS records found | 2024-10-10 | |
| messukirppis.fi | Expired 2019-02-06 | ||
| messuklubi.fi | No DNS records found | 2024-09-18 | |
| messukutsu.fi | No DNS records found | 2024-05-22 | |
| messumedia.fi | http://www.messumedia.fi/ | 2024-09-04 | |
| messuparkki.fi | No DNS records found | 2025-05-29 | |
| messut100.fi | No DNS records found | 2025-12-13 | |
| messutapahtumat.fi | No DNS records found | 2024-09-20 | |
| messuvalmennus.fi | No DNS records found | 2025-01-14 | |
| metsamessut.fi | https://metsa.messukeskus.com/ | 2025-05-16 | |
| metsämessut.fi | No DNS records found | 2024-05-16 | |
| metsastysmessut.fi | Expired 2024-04-22 | ||
| metsästysmessut.fi | Expired 2019-04-22 | ||
| model-expo.fi | Expired 2023-10-14 | ||
| modelexpo.fi | Expired 2023-10-14 | ||
| moottorikelkkamessut.fi | Expired 2024-03-29 | ||
| moottoripyoranayttely.fi | Expired 2024-02-19 | ||
| moottoripyöränäyttely.fi | No DNS records found | 2024-09-01 | |
| motokuume.fi | http://www.motokuume.fi/ | 2024-12-04 | |
| motokuumemittari.fi | Expired 2024-01-21 | ||
| mp-messut.fi | No DNS records found | 2024-09-29 | |
| mpmessut.fi | http://mp.messukeskus.com/ | 2025-02-21 | |
| mp-nayttely.fi | http://www.mp-nayttely.fi/ | 2025-02-19 | |
| mprock.fi | Expired 2023-06-21 | ||
| mpstars.fi | Expired 2023-11-02 | ||
| muotimessut.fi | No DNS records found | 2024-09-04 | |
| nayttely.fi | Expired 2023-09-05 | ||
| nbe.fi | Expired 2023-09-11 | ||
| nordictravelfair.fi | http://matka.messukeskus.com/?lang=en | 2024-10-06 | |
| oispatalvi.fi | http://www.oispatalvi.fi/ | 2024-09-14 | |
| omakotimessut.fi | http://kevatmessut.messukeskus.com/ | 2024-09-20 | |
| omamokki.fi | No DNS records found | 2024-09-04 | |
| omamökki.fi | No DNS records found | 2024-09-01 | |
| omapiha.fi | No DNS records found | 2024-09-04 | |
| onseala.fi | No DNS records found | 2025-03-21 | |
| outdoorexpo.fi | http://www.outdoorexpo.fi/ | 2024-12-16 | |
| pactec.fi | No DNS records found | 2024-08-31 | |
| petrolcircus.fi | No DNS records found | 2024-11-17 | |
| plastexpo.fi | Expired 2023-09-24 | ||
| pomppulinnataivas.fi | Expired 2023-10-25 | ||
| pranabeats.fi | Expired 2019-10-13 | ||
| pratkakuume.fi | Expired 2018-06-08 | ||
| promoexpo.fi | Expired 2023-11-21 | ||
| pulpandbeyond.fi | No DNS records found | 2025-05-11 | |
| pulpaper.fi | No DNS records found | 2024-09-04 | |
| pwaexpo.fi | Expired 2021-04-27 | ||
| pwa.fi | 2024-04-27 | ||
| reset16.fi | Expired 2020-01-29 | ||
| reset17.fi | Expired 2019-08-18 | ||
| reset2017.fi | Expired 2019-08-17 | ||
| retkimessut.fi | Expired 2024-02-19 | ||
| robtec.fi | Expired 2000-12-31 | ||
| ruokamessuthelsinki.fi | No DNS records found | 2025-01-09 | |
| sahko-electricity.fi | No DNS records found | 2025-03-25 | |
| sähkö-electricity.fi | No DNS records found | 2025-03-25 | |
| sahkoexpo.fi | http://www.sahkoexpo.fi/ | 2025-03-25 | |
| sähköexpo.fi | No DNS records found | 2025-03-25 | |
| sähkömessut.fi | No DNS records found | 2025-02-15 | |
| sairaanhoitajapaivatnayttely.fi | No DNS records found | 2025-04-20 | |
| sairaanhoitajapäivätnäyttely.fi | No DNS records found | 2025-04-20 | |
| seatechelsinki.fi | Expired 2000-12-31 | ||
| secd-day.fi | No DNS records found | 2025-02-19 | |
| seonala.fi | No DNS records found | 2025-04-19 | |
| showroomfair.fi | Expired 2023-11-23 | ||
| signtec.fi | Expired 2024-01-29 | ||
| sihteeriassistenttimessut.fi | Expired 2023-10-30 | ||
| sihteeriassistenttipaivat.fi | Expired 2023-10-30 | ||
| sihteeriassistenttipäivät.fi | Expired 2023-10-30 | ||
| sijoittaja23.fi | No DNS records found | 2025-05-15 | |
| sijoittaja25.fi | No DNS records found | 2025-05-15 | |
| sijoittaja26.fi | No DNS records found | 2025-05-15 | |
| sijoittaja27.fi | No DNS records found | 2025-05-15 | |
| sijoittajamessut.fi | https://sijoittajamessut.messukeskus.com/ | 2025-01-08 | |
| sisahuvipuisto.fi | No DNS records found | 2024-06-13 | |
| sisustamessut.fi | https://kevatmessut.messukeskus.com/ | 2024-06-14 | |
| sisustusmessut.fi | Expired 2024-03-28 | ||
| sporttitaivas.fi | https://messukeskus.com/wp-signup.php?new=www.sporttitaivas.... | 2024-06-15 | |
| studiamessut.fi | http://studia.messukeskus.com/ | 2024-10-29 | |
| suomenmessut.fi | http://messukeskus.com/ | 2024-08-31 | |
| suomenmetsamessut.fi | No DNS records found | 2025-07-03 | |
| suomenmetsämessut.fi | No DNS records found | 2024-07-03 | |
| suomenvideoviestinta.fi | http://www.suomenvideoviestinta.fi/ | 2024-08-24 | |
| svv.fi | https://svv.fi/ | 2024-09-04 | |
| tanssiviekoon.fi | Expired 2023-12-22 | ||
| teknologia17.fi | Expired 2019-03-19 | ||
| teknologia19.fi | Expired 2024-03-19 | ||
| teknologia21.fi | https://teknologia.messukeskus.com/ | 2024-10-16 | |
| teknologia22.fi | No DNS records found | 2024-09-28 | |
| teknologia23.fi | No DNS records found | 2025-02-20 | |
| teknologiatapahtuma.fi | No DNS records found | 2024-08-16 | |
| tempaudu.fi | No DNS records found | 2024-08-14 | |
| terveysmessut.fi | No DNS records found | 2024-09-04 | |
| terveytesimessut.fi | No DNS records found | 2024-06-08 | |
| tooltec.fi | https://teknologia.messukeskus.com/ | 2026-05-08 | |
| travelfair.fi | http://www.travelfair.fi/ | 2024-10-06 | |
| tsigaboom.fi | https://tsigaboom.messukeskus.com/ | 2024-08-15 | |
| turvallisuus2021.fi | Expired 2023-04-09 | ||
| turvallisuusmessut2021.fi | Expired 2023-04-09 | ||
| turvallisuustapahtuma.fi | No DNS records found | 2024-09-27 | |
| valomessut.fi | http://www.valomessut.fi/ | 2027-03-30 | |
| valotapahtuma.fi | Expired 2024-03-30 | ||
| varipinta.fi | Expired 2023-09-05 | ||
| väripinta.fi | Expired 2023-09-01 | ||
| venemessut.fi | http://vene.messukeskus.com/ | 2024-09-04 | |
| vihertek.fi | Expired 2023-11-04 | ||
| viiniexpo.fi | Expired 2023-09-04 | ||
| viiniruoka.fi | http://www.viiniruoka.fi/ | 2025-04-28 | |
| visitmatka.fi | No DNS records found | 2024-08-31 | |
| winterexpo.fi | Expired 2023-10-17 | ||
| woodexpo.fi | Expired 2023-11-18 | ||
| ymparistomessut.fi | Expired 2023-09-05 | ||
| ympäristömessut.fi | Expired 2023-09-01 | ||
| ymparistotekniikkamessut.fi | http://www.ymparistotekniikkamessut.fi/ | 2024-06-06 | |
| ympäristötekniikkamessut.fi | https://messukeskus.com/wp-signup.php?new=www.xn--ympristtek... | 2024-06-06 | |
| yritys2017.fi | Expired 2021-02-03 | ||
| yritys2018.fi | No DNS records found | 2027-01-26 |