båtmässa.fi
Yksityiskohdat
Lähde: Liikenne- ja viestintävirasto (Traficom) ja Internet Assched Numbers Authority (IANA)Tila | Registered |
Omistaja | Messuaukio 1, Finland |
Apurahan myöntämispäivä | 2005-09-01 |
Viimeinen voimassaolopäivä | 2025-09-01 |
Kirjaaja | Louhi Net Oy 00520 Helsinki |
Nimipalvelimet Katso lisätietoja DNS-osiosta | dns1.louhi.net dns2.louhi.net dns3.louhi.fi |
Onko DNSSec käytössä | No |
IANA-yksityiskohdat jälkiliitteelle | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Palvelimen IP-sijainti
Lähde: Varsinainen verkkosivu - Aikaleima: 2022-09-23 08:15VAROITUS: Huomaa, että sijainti voi olla täysin väärä, jos palvelin käyttää esimerkiksi käänteinen välityspalvelin, kuten Cloudflare
Server IP not valid or missing details in database. Map not shown
Sanapilvi båtmässa.fi
Valitettavasti tällä hetkellä ei ole tarpeeksi tietoa sanapilven jäsentämiseksi tälle sivustolle
Verkkosivun tiedot båtmässa.fi
Lähde: Varsinainen verkkosivu - Aikaleima: 2022-09-18 06:48Otsikkotiedot ja sisällönkuvauskentät | |
Open Graph (OG) sisällönkuvauskentät | Avoimen graafin tunnisteiden käyttöä suositellaan erittäin hyvin hakukoneoptimoinnissa |
Twitter-kortit | Twitter-tunnisteiden käyttäminen on erittäin suositeltavaa hakukoneoptimoinnissa (SEO) |
CSS-tyylisivut (CSS) | |
Sosiaalisen median (SOME) -linkit | Sosiaalisen median sisällön käyttäminen on erittäin suositeltavaa hakukoneoptimoinnille (SEO) |
JavaScript-kirjastot |
Evästeen tiedot båtmässa.fi
Lähde: Varsinainen verkkosivu - Aikaleima: 2022-09-18 06:48Evästeiden lukumäärä: 0
Evästeen verkkotunnus | Evästeiden arvot |
---|
Näyttökuva båtmässa.fi
DNS-tietueet verkkotunnukselle båtmässa.fi
Lähde: DNS-vastaus - Aikaleima: 2022-09-23 08:15A | xn--btmssa-duaf.fi 188.117.27.178 (Time to Live: 3600) |
MX | xn--btmssa-duaf.fi (Time to Live: 3600) |
NS | dns2.louhi.net
|
SOA | xn--btmssa-duaf.fi dns1.louhi.net (Time to Live: 3600) hostmaster.louhi.net |
Whois tallentaa historiaa båtmässa.fi
Lähde: Liikenne- ja viestintävirasto (Traficom)Näytetään viimeisin max 5 havaitut muutokset tietueissa. Muutokset on korostettu
Päivämäärä | 2021-01-19 | 2021-05-16 | 2022-05-13 | 2023-05-13 | 2024-05-10 |
---|---|---|---|---|---|
Name | båtmässa.fi | båtmässa.fi | båtmässa.fi | båtmässa.fi | båtmässa.fi |
State | Registered | Registered | Registered | Registered | Registered |
Holder | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta |
Address | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2005-09-01T08:01:35 | 2005-09-01T08:01:35 | 2005-09-01T08:01:35 | 2005-09-01T08:01:35 | 2005-09-01T08:01:35 |
Registrar | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy |
PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
PostalCode | 00520 | 00520 | 00520 | 00520 | 00520 |
NameServer1 | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net |
NameServer2 | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net |
NameServer3 | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi |
PhoneNumber | |||||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2021-09-01T08:01:35 | 2022-09-01T08:01:35 | 2023-09-01T08:01:35 | 2024-09-01T08:01:35 | 2025-09-01T08:01:35 |
DepartmentOrContactPerson |
Palvelimen vastaus båtmässa.fi
Lähde: Web-palvelimen vastaus - Aikaleima: 2022-09-23 08:15Lopullinen URL | |
HTTP-paluukoodi | |
IP-osoite | |
Palvelimen otsikko | Palvelin: Kautta: |
Sertifikaatti | Ei saatavilla Sertifikaatin käyttö on erittäin suositeltavaa hakukoneoptimoinnissa (SEO) Jos verkkosivustollasi on sertifikaatti ja näet edelleen tämän varoituksen,niin se tarkoittaa sitä että Web-palvelinta ei ole määritetty oikein ohjaamaan liikennettä https-osoitteeseen |
Käytetty tekniikka båtmässa.fi
Lähde: Verkkosivujen analyysi - Aikaleima: 2022-09-23 08:15Uusin arvostelu | 2022-09-23 08:15 |
Sivun kieli (otsikosta) | en (Tämä on usein vääriä!) |
Teknologiat | Lodash (JavaScript Libraries) (100% propable) Polyfill (JavaScript Libraries) (100% propable) React (JavaScript Frameworks) (100% propable) Wix (CMSEcommerceBlogs) (100% propable) |
Tunnetut aliverkkotunnukset båtmässa.fi
Lähde: Hakukoneet ja DNS-tietueet (VAROITUS: Suurin osa ei välttämättä ole tavoitettavissa (sisäinen / DMZ / vanhentunut)). Näytetään enimmäisrivit 700Aliverkkotunnuksia ei löytynyt
Web-palveluntarjoajat
Lähde: Kaikki voimassa olevat yrityssivustot, joissa on sisältöä (katso taulukko alla)
Saman omistajan omistamat verkkotunnukset (nykyinen ja aiempi)
Lähde: Liikenne- ja viestintävirasto (Traficom)Verkkotunnusten lukumäärä: 282
Verkkotunnus | Lopullinen URL (kun viimeksi testattu) | Linkit | Viimeinen voimassaoloaika |
---|---|---|---|
100ideaakevaaseen.fi | Vanhentunut 2023-01-27 | ||
55plus.fi | DNS-tietueita ei löytynyt | 2025-02-09 | |
agriexpo.fi | Vanhentunut 2023-11-23 | ||
agrikone.fi | Vanhentunut 2023-11-23 | ||
agrikonemessut.fi | Vanhentunut 2023-11-23 | ||
agrimessut.fi | Vanhentunut 2023-11-23 | ||
antiikkitapahtuma.fi | http://antiikki.messukeskus.com/ | 2024-11-27 | |
apconfinland.fi | Vanhentunut 2021-08-16 | ||
arenaexpo.fi | https://arena.messukeskus.com/ | 2024-06-14 | |
asujaremontoi.fi | DNS-tietueita ei löytynyt | 2024-10-25 | |
atvmessut.fi | Vanhentunut 2023-03-29 | ||
auto2017.fi | Vanhentunut 2000-12-31 | ||
auto2019.fi | http://auto.messukeskus.com/ | 2026-02-08 | |
auto2020.fi | Vanhentunut 2024-02-08 | ||
auto2021.fi | Vanhentunut 2024-02-08 | ||
auto2022.fi | Vanhentunut 2024-02-08 | ||
autokorjaamomessut.fi | https://autokorjaamo.messukeskus.com/ | 2024-09-20 | |
automaatiomessut.fi | Vanhentunut 2023-09-20 | ||
auto-messut.fi | http://auto.messukeskus.com/ | 2025-01-26 | |
båtmässa.fi | DNS-tietueita ei löytynyt | 2025-09-01 | |
beautyprocover.fi | http://iloveme.messukeskus.com/beauty-pro/ | 2025-05-03 | |
beautypromessut.fi | DNS-tietueita ei löytynyt | 2024-12-01 | |
bioenergyexpo.fi | Vanhentunut 2023-11-18 | ||
bioproductsexpo.fi | Vanhentunut 2023-11-18 | ||
bisnespaivat.fi | Vanhentunut 2024-01-03 | ||
bisnespäivät.fi | https://messukeskus.com/wp-signup.php?new=www.xn--bisnespivt... | 2026-01-03 | |
bolearenaclub.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
bolearena.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
böle.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
businesstravelforum.fi | https://matka.messukeskus.com/b2b/ | 2024-05-22 | |
caravanmessut.fi | https://caravan.messukeskus.com/ | 2024-09-20 | |
chembiofinland.fi | http://chembio.messukeskus.com/ | 2025-02-19 | |
congresscenter.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
congresscentre.fi | Vanhentunut 2023-09-05 | ||
conventioncenter.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
conventioncentre.fi | https://messukeskus.com/wp-signup.php?new=www.conventioncent... | 2027-06-13 | |
corefair.fi | Vanhentunut 2018-04-16 | ||
coremessut.fi | Vanhentunut 2018-04-16 | ||
digiexpo.fi | Vanhentunut 2024-02-19 | ||
educafair.fi | DNS-tietueita ei löytynyt | 2024-10-28 | |
educamessut.fi | DNS-tietueita ei löytynyt | 2025-04-07 | |
elainystavani.fi | DNS-tietueita ei löytynyt | 2025-05-20 | |
eläinystäväni.fi | DNS-tietueita ei löytynyt | 2025-05-20 | |
elmamessut.fi | https://elma.messukeskus.com/ | 2024-09-05 | |
eltekmessut.fi | Vanhentunut 2023-09-04 | ||
emessukeskus.fi | http://www.emessukeskus.fi/ | 2025-03-27 | |
enviroexpo.fi | Vanhentunut 2024-01-29 | ||
facetoface.fi | Vanhentunut 2023-09-07 | ||
fairnet.fi | Vanhentunut 2023-09-04 | ||
fillarimessut.fi | https://goexpo.messukeskus.com/ | 2024-09-05 | |
finlandsmassa.fi | Vanhentunut 2023-09-04 | ||
finlandsmässa.fi | Vanhentunut 2023-09-01 | ||
finnbuild.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
finnexpo.fi | Vanhentunut 2023-08-31 | ||
finnishdentalexhibition.fi | DNS-tietueita ei löytynyt | 2024-11-17 | |
finnishfaircorporation.fi | https://messukeskus.com/wp-signup.php?new=www.finnishfaircor... | 2024-09-04 | |
finnsec.fi | http://www.finnsec.fi/ | 2025-09-04 | |
foodtechelsinki.fi | https://pfsptec.messukeskus.com/ | 2025-04-07 | |
formakevat.fi | Vanhentunut 2023-09-03 | ||
formakevät.fi | Vanhentunut 2023-09-03 | ||
formasyksy.fi | Vanhentunut 2023-09-03 | ||
funexpo.fi | http://www.funexpo.fi/ | 2024-09-28 | |
gamexpo.fi | Vanhentunut 2023-11-17 | ||
gastro.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
gastrohelsinki.fi | DNS-tietueita ei löytynyt | 2025-03-20 | |
gastropro.fi | https://gastro.messukeskus.com/ | 2024-11-01 | |
globalworkshop.fi | https://matka.messukeskus.com/ | 2024-10-25 | |
goexpo.fi | https://goexpo.messukeskus.com/ | 2025-12-04 | |
goexpohorse.fi | Vanhentunut 2023-12-06 | ||
goexpowinter.fi | Vanhentunut 2023-10-17 | ||
golfexpo.fi | Vanhentunut 2024-03-05 | ||
golfmessut.fi | https://golfmessut.fi/ | 2024-09-05 | |
graftec.fi | Vanhentunut 2024-04-22 | ||
growthhelsinki.fi | Vanhentunut 2023-02-07 | ||
gswpro.fi | Vanhentunut 2000-12-31 | ||
habitare.fi | DNS-tietueita ei löytynyt | 2025-08-31 | |
habitarepro.fi | http://www.habitarepro.fi/ | 2024-09-22 | |
hammalääkäripäivätnäyttely.fi | Vanhentunut 2018-11-15 | ||
hammaslaakaripaivatnayttely.fi | DNS-tietueita ei löytynyt | 2024-11-15 | |
hammaslääkäripäivätnäyttely.fi | https://hammaslaakaripaivat.messukeskus.com/ | 2024-11-25 | |
helsingforsbokmassa.fi | https://kirjamessut.messukeskus.com/?lang=sv | 2024-09-05 | |
helsingforsbokmässa.fi | https://messukeskus.com/wp-signup.php?new=www.xn--helsingfor... | 2025-09-01 | |
helsingforsmasscentrum.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
helsingforsmässcentrum.fi | Vanhentunut 2019-09-01 | ||
helsingineramessut.fi | DNS-tietueita ei löytynyt | 2025-04-19 | |
helsinginerämessut.fi | DNS-tietueita ei löytynyt | 2025-04-19 | |
helsinginkirjamessut.fi | https://kirjamessut.messukeskus.com/ | 2024-09-05 | |
helsinginmessukeskus.fi | DNS-tietueita ei löytynyt | 2025-08-31 | |
helsinginmessut.fi | http://www.wanhasatama.com/ | 2025-08-31 | |
helsinginmetsamessut.fi | Vanhentunut 2024-01-08 | ||
helsinginmetsämessut.fi | Vanhentunut 2024-01-08 | ||
helsinginmusiikkimessut.fi | Vanhentunut 2023-10-22 | ||
helsinkiboatshow.fi | DNS-tietueita ei löytynyt | 2024-11-17 | |
helsinkibookfair.fi | DNS-tietueita ei löytynyt | 2024-09-05 | |
helsinkicf.fi | DNS-tietueita ei löytynyt | 2025-04-07 | |
helsinkiconventioncenter.fi | DNS-tietueita ei löytynyt | 2025-06-13 | |
helsinkiconventioncentre.fi | DNS-tietueita ei löytynyt | 2025-06-13 | |
helsinkiexhibitionandconventioncenter.fi | https://messukeskus.com/?lang=en | 2025-06-13 | |
helsinkiexhibitionandconventioncentre.fi | http://www.helsinkiexhibitionandconventioncentre.fi/ | 2025-06-13 | |
helsinkiexhibitioncenter.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
helsinkiexhibitioncentre.fi | DNS-tietueita ei löytynyt | 2025-06-13 | |
helsinkifaircentre.fi | http://messukeskus.com/?lang=en | 2025-09-04 | |
helsinkihorsefair.fi | http://www.helsinkihorsefair.fi/ | 2024-09-20 | |
highendhelsinki.fi | Vanhentunut 2024-01-18 | ||
highendhifi.fi | Vanhentunut 2024-01-16 | ||
himss.fi | DNS-tietueita ei löytynyt | 2024-11-16 | |
horsefair.fi | Vanhentunut 2024-04-23 | ||
hpmessut.fi | http://www.hpmessut.fi/ | 2024-06-07 | |
hupicon.fi | DNS-tietueita ei löytynyt | 2024-10-06 | |
iloveme.fi | http://iloveme.messukeskus.com/ | 2025-01-18 | |
infraexpo.fi | Vanhentunut 2024-01-31 | ||
jatevesiymparisto.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
jätevesiympäristö.fi | http://www.xn--jtevesiymprist-5hbj42a.fi/ | 2024-09-04 | |
jewelandwatch.fi | Vanhentunut 2023-11-27 | ||
jobforum.fi | Vanhentunut 2023-10-22 | ||
jointec.fi | Vanhentunut 2024-04-24 | ||
jonnela.fi | DNS-tietueita ei löytynyt | 2024-10-30 | |
jonnelaklubi.fi | DNS-tietueita ei löytynyt | 2024-10-30 | |
julkinenateria.fi | https://ateria.messukeskus.com/ | 2024-11-25 | |
julkisivumessut.fi | Vanhentunut 2019-01-18 | ||
kadentaitotapahtuma.fi | Vanhentunut 2024-02-26 | ||
kädentaitotapahtuma.fi | Vanhentunut 2024-02-26 | ||
kauneusmessut.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
kevaanmerkit.fi | Vanhentunut 2024-03-30 | ||
keväänmerkit.fi | Vanhentunut 2024-03-30 | ||
kevatmessut.fi | http://www.kevatmessut.fi/ | 2025-01-08 | |
kevätmessut.fi | http://www.xn--kevtmessut-s5a.fi/ | 2025-01-08 | |
kevatpuutarha.fi | http://kevatmessut.messukeskus.com/ | 2025-09-04 | |
kiinteistoklusteri.fi | Vanhentunut 2024-03-29 | ||
kiinteistöklusteri.fi | Vanhentunut 2024-03-29 | ||
kiinteistomessut.fi | http://www.kiinteistomessut.fi/ | 2024-09-20 | |
kiinteistömessut.fi | DNS-tietueita ei löytynyt | 2025-09-01 | |
kiinteistoplusturvallisuus.fi | Vanhentunut 2024-03-05 | ||
kiinteistöplusturvallisuus.fi | Vanhentunut 2024-03-05 | ||
kokoustamo.fi | Vanhentunut 2023-09-25 | ||
korjausjarakentaminen.fi | Vanhentunut 2023-09-07 | ||
korjausrakentaminen2018.fi | Vanhentunut 2023-10-04 | ||
korujakello.fi | Vanhentunut 2023-11-27 | ||
korujakellomessut.fi | Vanhentunut 2023-11-27 | ||
kuljetuslogistiikka.fi | Vanhentunut 2023-09-05 | ||
kutsutapahtumaan.fi | DNS-tietueita ei löytynyt | 2024-10-25 | |
laakaripaivatnayttely.fi | https://laakaripaivat.messukeskus.com/ | 2024-09-20 | |
lääkäripäivätnäyttely.fi | DNS-tietueita ei löytynyt | 2025-09-01 | |
lahiruokaluomu.fi | https://lahiruokajaluomu.messukeskus.com/ | 2024-09-21 | |
lähiruokaluomu.fi | https://kevatmessut.messukeskus.com/ | 2024-09-21 | |
lapsimessut.fi | https://lapsimessut.messukeskus.com/ | 2024-09-05 | |
lautasella.fi | DNS-tietueita ei löytynyt | 2025-06-08 | |
lemmikkitapahtuma.fi | DNS-tietueita ei löytynyt | 2024-12-16 | |
liikelahjamessut.fi | Vanhentunut 2019-10-30 | ||
liikelahjatmessut.fi | Vanhentunut 2019-10-30 | ||
logistiikkakuljetus.fi | Vanhentunut 2023-09-05 | ||
maatalouskonemessut.fi | https://maatalouskone.messukeskus.com/ | 2024-11-23 | |
maintec.fi | Vanhentunut 2018-04-22 | ||
manufacturingmaterials.fi | Vanhentunut 2023-10-30 | ||
markkinoinninviikko.fi | Vanhentunut 2024-03-09 | ||
matkahuutokauppa.fi | Vanhentunut 2019-12-13 | ||
matkailupalkinto.fi | Vanhentunut 2018-11-30 | ||
matkamessut.fi | DNS-tietueita ei löytynyt | 2024-09-05 | |
matkapro.fi | DNS-tietueita ei löytynyt | 2024-11-20 | |
maxpo.fi | http://www.maxpo.fi/ | 2025-09-04 | |
mecatec.fi | Vanhentunut 2023-08-31 | ||
meetfinland.fi | DNS-tietueita ei löytynyt | 2024-09-28 | |
meidanviikonloppu.fi | Vanhentunut 2024-02-18 | ||
meidänviikonloppu.fi | Vanhentunut 2024-02-18 | ||
mesoaja.fi | http://www.mesoaja.fi/ | 2024-07-31 | |
messuhelmi.fi | Vanhentunut 2018-05-29 | ||
messukeskus100.fi | Vanhentunut 2023-11-20 | ||
messukeskushelsinki.fi | DNS-tietueita ei löytynyt | 2024-10-10 | |
messukirppis.fi | Vanhentunut 2019-02-06 | ||
messuklubi.fi | DNS-tietueita ei löytynyt | 2024-09-18 | |
messukutsu.fi | DNS-tietueita ei löytynyt | 2024-05-22 | |
messumedia.fi | http://www.messumedia.fi/ | 2025-09-04 | |
messuparkki.fi | DNS-tietueita ei löytynyt | 2025-05-29 | |
messut100.fi | DNS-tietueita ei löytynyt | 2025-12-13 | |
messutapahtumat.fi | DNS-tietueita ei löytynyt | 2024-09-20 | |
messuvalmennus.fi | DNS-tietueita ei löytynyt | 2025-01-14 | |
metsamessut.fi | https://metsa.messukeskus.com/ | 2025-05-16 | |
metsämessut.fi | DNS-tietueita ei löytynyt | 2024-05-16 | |
metsastysmessut.fi | Vanhentunut 2024-04-22 | ||
metsästysmessut.fi | Vanhentunut 2019-04-22 | ||
model-expo.fi | Vanhentunut 2023-10-14 | ||
modelexpo.fi | Vanhentunut 2023-10-14 | ||
moottorikelkkamessut.fi | Vanhentunut 2024-03-29 | ||
moottoripyoranayttely.fi | Vanhentunut 2024-02-19 | ||
moottoripyöränäyttely.fi | DNS-tietueita ei löytynyt | 2025-09-01 | |
motokuume.fi | http://www.motokuume.fi/ | 2024-12-04 | |
motokuumemittari.fi | Vanhentunut 2024-01-21 | ||
mp-messut.fi | DNS-tietueita ei löytynyt | 2024-09-29 | |
mpmessut.fi | http://mp.messukeskus.com/ | 2025-02-21 | |
mp-nayttely.fi | http://www.mp-nayttely.fi/ | 2025-02-19 | |
mprock.fi | Vanhentunut 2023-06-21 | ||
mpstars.fi | Vanhentunut 2023-11-02 | ||
muotimessut.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
nayttely.fi | Vanhentunut 2023-09-05 | ||
nbe.fi | Vanhentunut 2023-09-11 | ||
nordictravelfair.fi | http://matka.messukeskus.com/?lang=en | 2024-10-06 | |
oispatalvi.fi | http://www.oispatalvi.fi/ | 2024-09-14 | |
omakotimessut.fi | http://kevatmessut.messukeskus.com/ | 2024-09-20 | |
omamokki.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
omamökki.fi | DNS-tietueita ei löytynyt | 2025-09-01 | |
omapiha.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
onseala.fi | DNS-tietueita ei löytynyt | 2025-03-21 | |
outdoorexpo.fi | http://www.outdoorexpo.fi/ | 2024-12-16 | |
pactec.fi | DNS-tietueita ei löytynyt | 2025-08-31 | |
petrolcircus.fi | DNS-tietueita ei löytynyt | 2024-11-17 | |
plastexpo.fi | Vanhentunut 2023-09-24 | ||
pomppulinnataivas.fi | Vanhentunut 2023-10-25 | ||
pranabeats.fi | Vanhentunut 2019-10-13 | ||
pratkakuume.fi | Vanhentunut 2018-06-08 | ||
promoexpo.fi | Vanhentunut 2023-11-21 | ||
pulpandbeyond.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
pulpaper.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
pwaexpo.fi | Vanhentunut 2021-04-27 | ||
pwa.fi | Vanhentunut 2024-04-27 | ||
reset16.fi | Vanhentunut 2020-01-29 | ||
reset17.fi | Vanhentunut 2019-08-18 | ||
reset2017.fi | Vanhentunut 2019-08-17 | ||
retkimessut.fi | Vanhentunut 2024-02-19 | ||
robtec.fi | Vanhentunut 2000-12-31 | ||
ruokamessuthelsinki.fi | DNS-tietueita ei löytynyt | 2025-01-09 | |
sahko-electricity.fi | DNS-tietueita ei löytynyt | 2025-03-25 | |
sähkö-electricity.fi | DNS-tietueita ei löytynyt | 2025-03-25 | |
sahkoexpo.fi | http://www.sahkoexpo.fi/ | 2025-03-25 | |
sähköexpo.fi | DNS-tietueita ei löytynyt | 2025-03-25 | |
sähkömessut.fi | DNS-tietueita ei löytynyt | 2025-02-15 | |
sairaanhoitajapaivatnayttely.fi | DNS-tietueita ei löytynyt | 2025-04-20 | |
sairaanhoitajapäivätnäyttely.fi | DNS-tietueita ei löytynyt | 2025-04-20 | |
seatechelsinki.fi | Vanhentunut 2000-12-31 | ||
secd-day.fi | DNS-tietueita ei löytynyt | 2025-02-19 | |
seonala.fi | DNS-tietueita ei löytynyt | 2025-04-19 | |
showroomfair.fi | Vanhentunut 2023-11-23 | ||
signtec.fi | Vanhentunut 2024-01-29 | ||
sihteeriassistenttimessut.fi | Vanhentunut 2023-10-30 | ||
sihteeriassistenttipaivat.fi | Vanhentunut 2023-10-30 | ||
sihteeriassistenttipäivät.fi | Vanhentunut 2023-10-30 | ||
sijoittaja23.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
sijoittaja25.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
sijoittaja26.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
sijoittaja27.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
sijoittajamessut.fi | https://sijoittajamessut.messukeskus.com/ | 2025-01-08 | |
sisahuvipuisto.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
sisustamessut.fi | https://kevatmessut.messukeskus.com/ | 2024-06-14 | |
sporttitaivas.fi | https://messukeskus.com/wp-signup.php?new=www.sporttitaivas.... | 2024-06-15 | |
studiamessut.fi | http://studia.messukeskus.com/ | 2024-10-29 | |
suomenmessut.fi | http://messukeskus.com/ | 2025-08-31 | |
suomenmetsamessut.fi | DNS-tietueita ei löytynyt | 2026-07-03 | |
suomenmetsämessut.fi | DNS-tietueita ei löytynyt | 2024-07-03 | |
suomenvideoviestinta.fi | http://www.suomenvideoviestinta.fi/ | 2025-08-24 | |
svv.fi | https://svv.fi/ | 2024-09-04 | |
tanssiviekoon.fi | Vanhentunut 2023-12-22 | ||
teknologia17.fi | Vanhentunut 2019-03-19 | ||
teknologia19.fi | Vanhentunut 2024-03-19 | ||
teknologia21.fi | https://teknologia.messukeskus.com/ | 2024-10-16 | |
teknologia22.fi | DNS-tietueita ei löytynyt | 2024-09-28 | |
teknologia23.fi | DNS-tietueita ei löytynyt | 2025-02-20 | |
teknologiatapahtuma.fi | DNS-tietueita ei löytynyt | 2024-08-16 | |
tempaudu.fi | DNS-tietueita ei löytynyt | 2025-08-14 | |
terveysmessut.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
terveytesimessut.fi | DNS-tietueita ei löytynyt | 2024-06-08 | |
tooltec.fi | https://teknologia.messukeskus.com/ | 2026-05-08 | |
travelfair.fi | http://www.travelfair.fi/ | 2024-10-06 | |
tsigaboom.fi | https://tsigaboom.messukeskus.com/ | 2024-08-15 | |
turvallisuus2021.fi | Vanhentunut 2023-04-09 | ||
turvallisuusmessut2021.fi | Vanhentunut 2023-04-09 | ||
turvallisuustapahtuma.fi | DNS-tietueita ei löytynyt | 2024-09-27 | |
valomessut.fi | http://www.valomessut.fi/ | 2027-03-30 | |
valotapahtuma.fi | Vanhentunut 2024-03-30 | ||
varipinta.fi | Vanhentunut 2023-09-05 | ||
väripinta.fi | Vanhentunut 2023-09-01 | ||
venemessut.fi | http://vene.messukeskus.com/ | 2025-09-04 | |
vihertek.fi | Vanhentunut 2023-11-04 | ||
viiniexpo.fi | Vanhentunut 2023-09-04 | ||
viiniruoka.fi | http://www.viiniruoka.fi/ | 2025-04-28 | |
visitmatka.fi | DNS-tietueita ei löytynyt | 2025-08-31 | |
winterexpo.fi | Vanhentunut 2023-10-17 | ||
woodexpo.fi | Vanhentunut 2023-11-18 | ||
ymparistomessut.fi | Vanhentunut 2023-09-05 | ||
ympäristömessut.fi | Vanhentunut 2023-09-01 | ||
ymparistotekniikkamessut.fi | http://www.ymparistotekniikkamessut.fi/ | 2024-06-06 | |
ympäristötekniikkamessut.fi | https://messukeskus.com/wp-signup.php?new=www.xn--ympristtek... | 2024-06-06 | |
yritys2017.fi | Vanhentunut 2021-02-03 | ||
yritys2018.fi | DNS-tietueita ei löytynyt | 2027-01-26 |