facetoface.fi
Yksityiskohdat
Lähde: Liikenne- ja viestintävirasto (Traficom) ja Internet Assched Numbers Authority (IANA)Tila | Validity expired |
Omistaja | Messuaukio 1, Finland |
Apurahan myöntämispäivä | 2006-09-07 |
Viimeinen voimassaolopäivä | 2023-09-07 |
Kirjaaja | Louhi Net Oy 00520 Helsinki |
Nimipalvelimet Katso lisätietoja DNS-osiosta | dns1.louhi.net dns2.louhi.net dns3.louhi.fi |
Onko DNSSec käytössä | No |
IANA-yksityiskohdat jälkiliitteelle | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Palvelimen IP-sijainti
Lähde: Varsinainen verkkosivu - Aikaleima: 2022-10-15 16:24VAROITUS: Huomaa, että sijainti voi olla täysin väärä, jos palvelin käyttää esimerkiksi käänteinen välityspalvelin, kuten Cloudflare
IP source | IP address | ASN block data | IP Geolocation |
---|---|---|---|
Käyttäjän IP | 18.220.16.184 | Tätä ei ole toistaiseksi haettu | Country: United States (US) State: Ohio (OH) City: Columbus Postal code: 43215 Latitude: 39,9653 Longitude: -83,0235 Network: 18.220.0.0/18 |
Palvelimen IP osoite | Autonomous System (AS) #: 29422 BGP prefix: 188.117.0.0/18 Country Code: FI Registry: ripencc Allocated: 2009-06-11 Tiedot: NBLNETWORKS-AS Nebula Oy, FI | Country: Finland (FI) State: Uusimaa (18) City: Helsinki Postal code: 00720 Latitude: 60,2448 Longitude: 24,9912 Network: 188.117.16.0/20 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Sanapilvi facetoface.fi
Valitettavasti tällä hetkellä ei ole tarpeeksi tietoa sanapilven jäsentämiseksi tälle sivustolle
Verkkosivun tiedot facetoface.fi
Lähde: Varsinainen verkkosivu - Aikaleima: 2022-11-29 09:43Otsikkotiedot ja sisällönkuvauskentät | |
Open Graph (OG) sisällönkuvauskentät | Avoimen graafin tunnisteiden käyttöä suositellaan erittäin hyvin hakukoneoptimoinnissa |
Twitter-kortit | Twitter-tunnisteiden käyttäminen on erittäin suositeltavaa hakukoneoptimoinnissa (SEO) |
CSS-tyylisivut (CSS) | |
Sosiaalisen median (SOME) -linkit | Sosiaalisen median sisällön käyttäminen on erittäin suositeltavaa hakukoneoptimoinnille (SEO) |
JavaScript-kirjastot |
Evästeen tiedot facetoface.fi
Lähde: Varsinainen verkkosivu - Aikaleima: 2022-11-29 09:43Evästeiden lukumäärä: 0
Evästeen verkkotunnus | Evästeiden arvot |
---|
Näyttökuva facetoface.fi
Lähde: Varsinainen verkkosivu - Aikaleima: 2022-10-15 16:24
DNS-tietueet verkkotunnukselle facetoface.fi
Lähde: DNS-vastaus - Aikaleima: 2022-10-15 16:24A | facetoface.fi 188.117.27.178 (Time to Live: 3600) |
MX | facetoface.fi (Time to Live: 3600) |
NS | dns2.louhi.net
|
SOA | facetoface.fi dns1.louhi.net (Time to Live: 3600) hostmaster.louhi.net |
Whois tallentaa historiaa facetoface.fi
Lähde: Liikenne- ja viestintävirasto (Traficom)Näytetään viimeisin max 5 havaitut muutokset tietueissa. Muutokset on korostettu
Päivämäärä | 2020-05-16 | 2021-01-19 | 2021-05-16 | 2022-05-13 | 2023-09-10 |
---|---|---|---|---|---|
Name | facetoface.fi | facetoface.fi | facetoface.fi | facetoface.fi | facetoface.fi |
State | Registered | Registered | Registered | Registered | Validity expired |
Holder | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta |
Address | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2006-09-07T17:57:06 | 2006-09-07T17:57:06 | 2006-09-07T17:57:06 | 2006-09-07T17:57:06 | 2006-09-07T17:57:06 |
Registrar | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy |
PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
PostalCode | 00520 | 00520 | 00520 | 00520 | 00520 |
NameServer1 | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net |
NameServer2 | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net |
NameServer3 | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi |
PhoneNumber | +358404503250 | ||||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2021-09-07T17:57:06 | 2021-09-07T17:57:06 | 2022-09-07T17:57:06 | 2023-09-07T17:57:06 | 2023-09-07T17:57:06 |
DepartmentOrContactPerson |
Palvelimen vastaus facetoface.fi
Lähde: Web-palvelimen vastaus - Aikaleima: 2022-10-15 16:24Lopullinen URL | http://www.facetoface.fi/ |
HTTP-paluukoodi | HTTP/1.1 301 Moved Permanently |
IP-osoite | 188.117.27.178 Autonomous System (AS) #: 29422 BGP prefix: 188.117.0.0/18 Country Code: Finland (FI) Registry: ripencc Allocated: 2009-06-11 Tiedot: NBLNETWORKS-AS Nebula Oy, FI |
Palvelimen otsikko | Palvelin: Kautta: |
Sertifikaatti | Ei saatavilla Sertifikaatin käyttö on erittäin suositeltavaa hakukoneoptimoinnissa (SEO) Jos verkkosivustollasi on sertifikaatti ja näet edelleen tämän varoituksen,niin se tarkoittaa sitä että Web-palvelinta ei ole määritetty oikein ohjaamaan liikennettä https-osoitteeseen |
Käytetty tekniikka facetoface.fi
Lähde: Verkkosivujen analyysi - Aikaleima: 2022-10-15 16:24Uusin arvostelu | 2022-10-15 16:24 |
Sivun kieli (otsikosta) | (Tämä on usein vääriä!) |
Teknologiat | Microsoft ASP.NET (Web Application Frameworks) (100% propable) Nginx (Web ServersReverse Proxy) (100% propable) Sitefinity 3.7.2136.240:1 (CMS) (100% propable) |
Tunnetut aliverkkotunnukset facetoface.fi
Lähde: Hakukoneet ja DNS-tietueet (VAROITUS: Suurin osa ei välttämättä ole tavoitettavissa (sisäinen / DMZ / vanhentunut)). Näytetään enimmäisrivit 700Löydettyjen aliverkkotunnusten lukumäärä: 1
Subdomain | IP-osoite |
---|---|
www.facetoface.fi | 188.117.27.178 |
Web-palveluntarjoajat
Lähde: Kaikki voimassa olevat yrityssivustot, joissa on sisältöä (katso taulukko alla)
Saman omistajan omistamat verkkotunnukset (nykyinen ja aiempi)
Lähde: Liikenne- ja viestintävirasto (Traficom)Verkkotunnusten lukumäärä: 282
Verkkotunnus | Lopullinen URL (kun viimeksi testattu) | Linkit | Viimeinen voimassaoloaika |
---|---|---|---|
100ideaakevaaseen.fi | Vanhentunut 2023-01-27 | ||
55plus.fi | DNS-tietueita ei löytynyt | 2025-02-09 | |
agriexpo.fi | Vanhentunut 2023-11-23 | ||
agrikone.fi | Vanhentunut 2023-11-23 | ||
agrikonemessut.fi | Vanhentunut 2023-11-23 | ||
agrimessut.fi | Vanhentunut 2023-11-23 | ||
antiikkitapahtuma.fi | http://antiikki.messukeskus.com/ | 2024-11-27 | |
apconfinland.fi | Vanhentunut 2021-08-16 | ||
arenaexpo.fi | https://arena.messukeskus.com/ | 2024-06-14 | |
asujaremontoi.fi | DNS-tietueita ei löytynyt | 2024-10-25 | |
atvmessut.fi | Vanhentunut 2023-03-29 | ||
auto2017.fi | Vanhentunut 2000-12-31 | ||
auto2019.fi | http://auto.messukeskus.com/ | 2026-02-08 | |
auto2020.fi | Vanhentunut 2024-02-08 | ||
auto2021.fi | Vanhentunut 2024-02-08 | ||
auto2022.fi | Vanhentunut 2024-02-08 | ||
autokorjaamomessut.fi | https://autokorjaamo.messukeskus.com/ | 2024-09-20 | |
automaatiomessut.fi | Vanhentunut 2023-09-20 | ||
auto-messut.fi | http://auto.messukeskus.com/ | 2025-01-26 | |
båtmässa.fi | DNS-tietueita ei löytynyt | 2025-09-01 | |
beautyprocover.fi | http://iloveme.messukeskus.com/beauty-pro/ | 2025-05-03 | |
beautypromessut.fi | DNS-tietueita ei löytynyt | 2024-12-01 | |
bioenergyexpo.fi | Vanhentunut 2023-11-18 | ||
bioproductsexpo.fi | Vanhentunut 2023-11-18 | ||
bisnespaivat.fi | Vanhentunut 2024-01-03 | ||
bisnespäivät.fi | https://messukeskus.com/wp-signup.php?new=www.xn--bisnespivt... | 2026-01-03 | |
bolearenaclub.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
bolearena.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
böle.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
businesstravelforum.fi | https://matka.messukeskus.com/b2b/ | 2024-05-22 | |
caravanmessut.fi | https://caravan.messukeskus.com/ | 2024-09-20 | |
chembiofinland.fi | http://chembio.messukeskus.com/ | 2025-02-19 | |
congresscenter.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
congresscentre.fi | Vanhentunut 2023-09-05 | ||
conventioncenter.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
conventioncentre.fi | https://messukeskus.com/wp-signup.php?new=www.conventioncent... | 2027-06-13 | |
corefair.fi | Vanhentunut 2018-04-16 | ||
coremessut.fi | Vanhentunut 2018-04-16 | ||
digiexpo.fi | Vanhentunut 2024-02-19 | ||
educafair.fi | DNS-tietueita ei löytynyt | 2024-10-28 | |
educamessut.fi | DNS-tietueita ei löytynyt | 2025-04-07 | |
elainystavani.fi | DNS-tietueita ei löytynyt | 2025-05-20 | |
eläinystäväni.fi | DNS-tietueita ei löytynyt | 2025-05-20 | |
elmamessut.fi | https://elma.messukeskus.com/ | 2024-09-05 | |
eltekmessut.fi | Vanhentunut 2023-09-04 | ||
emessukeskus.fi | http://www.emessukeskus.fi/ | 2025-03-27 | |
enviroexpo.fi | Vanhentunut 2024-01-29 | ||
facetoface.fi | Vanhentunut 2023-09-07 | ||
fairnet.fi | Vanhentunut 2023-09-04 | ||
fillarimessut.fi | https://goexpo.messukeskus.com/ | 2024-09-05 | |
finlandsmassa.fi | Vanhentunut 2023-09-04 | ||
finlandsmässa.fi | Vanhentunut 2023-09-01 | ||
finnbuild.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
finnexpo.fi | Vanhentunut 2023-08-31 | ||
finnishdentalexhibition.fi | DNS-tietueita ei löytynyt | 2024-11-17 | |
finnishfaircorporation.fi | https://messukeskus.com/wp-signup.php?new=www.finnishfaircor... | 2024-09-04 | |
finnsec.fi | http://www.finnsec.fi/ | 2025-09-04 | |
foodtechelsinki.fi | https://pfsptec.messukeskus.com/ | 2025-04-07 | |
formakevat.fi | Vanhentunut 2023-09-03 | ||
formakevät.fi | Vanhentunut 2023-09-03 | ||
formasyksy.fi | Vanhentunut 2023-09-03 | ||
funexpo.fi | http://www.funexpo.fi/ | 2024-09-28 | |
gamexpo.fi | Vanhentunut 2023-11-17 | ||
gastro.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
gastrohelsinki.fi | DNS-tietueita ei löytynyt | 2025-03-20 | |
gastropro.fi | https://gastro.messukeskus.com/ | 2024-11-01 | |
globalworkshop.fi | https://matka.messukeskus.com/ | 2024-10-25 | |
goexpo.fi | https://goexpo.messukeskus.com/ | 2025-12-04 | |
goexpohorse.fi | Vanhentunut 2023-12-06 | ||
goexpowinter.fi | Vanhentunut 2023-10-17 | ||
golfexpo.fi | Vanhentunut 2024-03-05 | ||
golfmessut.fi | https://golfmessut.fi/ | 2024-09-05 | |
graftec.fi | Vanhentunut 2024-04-22 | ||
growthhelsinki.fi | Vanhentunut 2023-02-07 | ||
gswpro.fi | Vanhentunut 2000-12-31 | ||
habitare.fi | DNS-tietueita ei löytynyt | 2025-08-31 | |
habitarepro.fi | http://www.habitarepro.fi/ | 2024-09-22 | |
hammalääkäripäivätnäyttely.fi | Vanhentunut 2018-11-15 | ||
hammaslaakaripaivatnayttely.fi | DNS-tietueita ei löytynyt | 2024-11-15 | |
hammaslääkäripäivätnäyttely.fi | https://hammaslaakaripaivat.messukeskus.com/ | 2024-11-25 | |
helsingforsbokmassa.fi | https://kirjamessut.messukeskus.com/?lang=sv | 2024-09-05 | |
helsingforsbokmässa.fi | https://messukeskus.com/wp-signup.php?new=www.xn--helsingfor... | 2025-09-01 | |
helsingforsmasscentrum.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
helsingforsmässcentrum.fi | Vanhentunut 2019-09-01 | ||
helsingineramessut.fi | DNS-tietueita ei löytynyt | 2025-04-19 | |
helsinginerämessut.fi | DNS-tietueita ei löytynyt | 2025-04-19 | |
helsinginkirjamessut.fi | https://kirjamessut.messukeskus.com/ | 2024-09-05 | |
helsinginmessukeskus.fi | DNS-tietueita ei löytynyt | 2025-08-31 | |
helsinginmessut.fi | http://www.wanhasatama.com/ | 2025-08-31 | |
helsinginmetsamessut.fi | Vanhentunut 2024-01-08 | ||
helsinginmetsämessut.fi | Vanhentunut 2024-01-08 | ||
helsinginmusiikkimessut.fi | Vanhentunut 2023-10-22 | ||
helsinkiboatshow.fi | DNS-tietueita ei löytynyt | 2024-11-17 | |
helsinkibookfair.fi | DNS-tietueita ei löytynyt | 2024-09-05 | |
helsinkicf.fi | DNS-tietueita ei löytynyt | 2025-04-07 | |
helsinkiconventioncenter.fi | DNS-tietueita ei löytynyt | 2025-06-13 | |
helsinkiconventioncentre.fi | DNS-tietueita ei löytynyt | 2025-06-13 | |
helsinkiexhibitionandconventioncenter.fi | https://messukeskus.com/?lang=en | 2025-06-13 | |
helsinkiexhibitionandconventioncentre.fi | http://www.helsinkiexhibitionandconventioncentre.fi/ | 2025-06-13 | |
helsinkiexhibitioncenter.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
helsinkiexhibitioncentre.fi | DNS-tietueita ei löytynyt | 2025-06-13 | |
helsinkifaircentre.fi | http://messukeskus.com/?lang=en | 2025-09-04 | |
helsinkihorsefair.fi | http://www.helsinkihorsefair.fi/ | 2024-09-20 | |
highendhelsinki.fi | Vanhentunut 2024-01-18 | ||
highendhifi.fi | Vanhentunut 2024-01-16 | ||
himss.fi | DNS-tietueita ei löytynyt | 2024-11-16 | |
horsefair.fi | Vanhentunut 2024-04-23 | ||
hpmessut.fi | http://www.hpmessut.fi/ | 2024-06-07 | |
hupicon.fi | DNS-tietueita ei löytynyt | 2024-10-06 | |
iloveme.fi | http://iloveme.messukeskus.com/ | 2025-01-18 | |
infraexpo.fi | Vanhentunut 2024-01-31 | ||
jatevesiymparisto.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
jätevesiympäristö.fi | http://www.xn--jtevesiymprist-5hbj42a.fi/ | 2024-09-04 | |
jewelandwatch.fi | Vanhentunut 2023-11-27 | ||
jobforum.fi | Vanhentunut 2023-10-22 | ||
jointec.fi | Vanhentunut 2024-04-24 | ||
jonnela.fi | DNS-tietueita ei löytynyt | 2024-10-30 | |
jonnelaklubi.fi | DNS-tietueita ei löytynyt | 2024-10-30 | |
julkinenateria.fi | https://ateria.messukeskus.com/ | 2024-11-25 | |
julkisivumessut.fi | Vanhentunut 2019-01-18 | ||
kadentaitotapahtuma.fi | Vanhentunut 2024-02-26 | ||
kädentaitotapahtuma.fi | Vanhentunut 2024-02-26 | ||
kauneusmessut.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
kevaanmerkit.fi | Vanhentunut 2024-03-30 | ||
keväänmerkit.fi | Vanhentunut 2024-03-30 | ||
kevatmessut.fi | http://www.kevatmessut.fi/ | 2025-01-08 | |
kevätmessut.fi | http://www.xn--kevtmessut-s5a.fi/ | 2025-01-08 | |
kevatpuutarha.fi | http://kevatmessut.messukeskus.com/ | 2025-09-04 | |
kiinteistoklusteri.fi | Vanhentunut 2024-03-29 | ||
kiinteistöklusteri.fi | Vanhentunut 2024-03-29 | ||
kiinteistomessut.fi | http://www.kiinteistomessut.fi/ | 2024-09-20 | |
kiinteistömessut.fi | DNS-tietueita ei löytynyt | 2025-09-01 | |
kiinteistoplusturvallisuus.fi | Vanhentunut 2024-03-05 | ||
kiinteistöplusturvallisuus.fi | Vanhentunut 2024-03-05 | ||
kokoustamo.fi | Vanhentunut 2023-09-25 | ||
korjausjarakentaminen.fi | Vanhentunut 2023-09-07 | ||
korjausrakentaminen2018.fi | Vanhentunut 2023-10-04 | ||
korujakello.fi | Vanhentunut 2023-11-27 | ||
korujakellomessut.fi | Vanhentunut 2023-11-27 | ||
kuljetuslogistiikka.fi | Vanhentunut 2023-09-05 | ||
kutsutapahtumaan.fi | DNS-tietueita ei löytynyt | 2024-10-25 | |
laakaripaivatnayttely.fi | https://laakaripaivat.messukeskus.com/ | 2024-09-20 | |
lääkäripäivätnäyttely.fi | DNS-tietueita ei löytynyt | 2025-09-01 | |
lahiruokaluomu.fi | https://lahiruokajaluomu.messukeskus.com/ | 2024-09-21 | |
lähiruokaluomu.fi | https://kevatmessut.messukeskus.com/ | 2024-09-21 | |
lapsimessut.fi | https://lapsimessut.messukeskus.com/ | 2024-09-05 | |
lautasella.fi | DNS-tietueita ei löytynyt | 2025-06-08 | |
lemmikkitapahtuma.fi | DNS-tietueita ei löytynyt | 2024-12-16 | |
liikelahjamessut.fi | Vanhentunut 2019-10-30 | ||
liikelahjatmessut.fi | Vanhentunut 2019-10-30 | ||
logistiikkakuljetus.fi | Vanhentunut 2023-09-05 | ||
maatalouskonemessut.fi | https://maatalouskone.messukeskus.com/ | 2024-11-23 | |
maintec.fi | Vanhentunut 2018-04-22 | ||
manufacturingmaterials.fi | Vanhentunut 2023-10-30 | ||
markkinoinninviikko.fi | Vanhentunut 2024-03-09 | ||
matkahuutokauppa.fi | Vanhentunut 2019-12-13 | ||
matkailupalkinto.fi | Vanhentunut 2018-11-30 | ||
matkamessut.fi | DNS-tietueita ei löytynyt | 2024-09-05 | |
matkapro.fi | DNS-tietueita ei löytynyt | 2024-11-20 | |
maxpo.fi | http://www.maxpo.fi/ | 2025-09-04 | |
mecatec.fi | Vanhentunut 2023-08-31 | ||
meetfinland.fi | DNS-tietueita ei löytynyt | 2024-09-28 | |
meidanviikonloppu.fi | Vanhentunut 2024-02-18 | ||
meidänviikonloppu.fi | Vanhentunut 2024-02-18 | ||
mesoaja.fi | http://www.mesoaja.fi/ | 2024-07-31 | |
messuhelmi.fi | Vanhentunut 2018-05-29 | ||
messukeskus100.fi | Vanhentunut 2023-11-20 | ||
messukeskushelsinki.fi | DNS-tietueita ei löytynyt | 2024-10-10 | |
messukirppis.fi | Vanhentunut 2019-02-06 | ||
messuklubi.fi | DNS-tietueita ei löytynyt | 2024-09-18 | |
messukutsu.fi | DNS-tietueita ei löytynyt | 2024-05-22 | |
messumedia.fi | http://www.messumedia.fi/ | 2025-09-04 | |
messuparkki.fi | DNS-tietueita ei löytynyt | 2025-05-29 | |
messut100.fi | DNS-tietueita ei löytynyt | 2025-12-13 | |
messutapahtumat.fi | DNS-tietueita ei löytynyt | 2024-09-20 | |
messuvalmennus.fi | DNS-tietueita ei löytynyt | 2025-01-14 | |
metsamessut.fi | https://metsa.messukeskus.com/ | 2025-05-16 | |
metsämessut.fi | DNS-tietueita ei löytynyt | 2024-05-16 | |
metsastysmessut.fi | Vanhentunut 2024-04-22 | ||
metsästysmessut.fi | Vanhentunut 2019-04-22 | ||
model-expo.fi | Vanhentunut 2023-10-14 | ||
modelexpo.fi | Vanhentunut 2023-10-14 | ||
moottorikelkkamessut.fi | Vanhentunut 2024-03-29 | ||
moottoripyoranayttely.fi | Vanhentunut 2024-02-19 | ||
moottoripyöränäyttely.fi | DNS-tietueita ei löytynyt | 2025-09-01 | |
motokuume.fi | http://www.motokuume.fi/ | 2024-12-04 | |
motokuumemittari.fi | Vanhentunut 2024-01-21 | ||
mp-messut.fi | DNS-tietueita ei löytynyt | 2024-09-29 | |
mpmessut.fi | http://mp.messukeskus.com/ | 2025-02-21 | |
mp-nayttely.fi | http://www.mp-nayttely.fi/ | 2025-02-19 | |
mprock.fi | Vanhentunut 2023-06-21 | ||
mpstars.fi | Vanhentunut 2023-11-02 | ||
muotimessut.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
nayttely.fi | Vanhentunut 2023-09-05 | ||
nbe.fi | Vanhentunut 2023-09-11 | ||
nordictravelfair.fi | http://matka.messukeskus.com/?lang=en | 2024-10-06 | |
oispatalvi.fi | http://www.oispatalvi.fi/ | 2024-09-14 | |
omakotimessut.fi | http://kevatmessut.messukeskus.com/ | 2024-09-20 | |
omamokki.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
omamökki.fi | DNS-tietueita ei löytynyt | 2025-09-01 | |
omapiha.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
onseala.fi | DNS-tietueita ei löytynyt | 2025-03-21 | |
outdoorexpo.fi | http://www.outdoorexpo.fi/ | 2024-12-16 | |
pactec.fi | DNS-tietueita ei löytynyt | 2025-08-31 | |
petrolcircus.fi | DNS-tietueita ei löytynyt | 2024-11-17 | |
plastexpo.fi | Vanhentunut 2023-09-24 | ||
pomppulinnataivas.fi | Vanhentunut 2023-10-25 | ||
pranabeats.fi | Vanhentunut 2019-10-13 | ||
pratkakuume.fi | Vanhentunut 2018-06-08 | ||
promoexpo.fi | Vanhentunut 2023-11-21 | ||
pulpandbeyond.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
pulpaper.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
pwaexpo.fi | Vanhentunut 2021-04-27 | ||
pwa.fi | Vanhentunut 2024-04-27 | ||
reset16.fi | Vanhentunut 2020-01-29 | ||
reset17.fi | Vanhentunut 2019-08-18 | ||
reset2017.fi | Vanhentunut 2019-08-17 | ||
retkimessut.fi | Vanhentunut 2024-02-19 | ||
robtec.fi | Vanhentunut 2000-12-31 | ||
ruokamessuthelsinki.fi | DNS-tietueita ei löytynyt | 2025-01-09 | |
sahko-electricity.fi | DNS-tietueita ei löytynyt | 2025-03-25 | |
sähkö-electricity.fi | DNS-tietueita ei löytynyt | 2025-03-25 | |
sahkoexpo.fi | http://www.sahkoexpo.fi/ | 2025-03-25 | |
sähköexpo.fi | DNS-tietueita ei löytynyt | 2025-03-25 | |
sähkömessut.fi | DNS-tietueita ei löytynyt | 2025-02-15 | |
sairaanhoitajapaivatnayttely.fi | DNS-tietueita ei löytynyt | 2025-04-20 | |
sairaanhoitajapäivätnäyttely.fi | DNS-tietueita ei löytynyt | 2025-04-20 | |
seatechelsinki.fi | Vanhentunut 2000-12-31 | ||
secd-day.fi | DNS-tietueita ei löytynyt | 2025-02-19 | |
seonala.fi | DNS-tietueita ei löytynyt | 2025-04-19 | |
showroomfair.fi | Vanhentunut 2023-11-23 | ||
signtec.fi | Vanhentunut 2024-01-29 | ||
sihteeriassistenttimessut.fi | Vanhentunut 2023-10-30 | ||
sihteeriassistenttipaivat.fi | Vanhentunut 2023-10-30 | ||
sihteeriassistenttipäivät.fi | Vanhentunut 2023-10-30 | ||
sijoittaja23.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
sijoittaja25.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
sijoittaja26.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
sijoittaja27.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
sijoittajamessut.fi | https://sijoittajamessut.messukeskus.com/ | 2025-01-08 | |
sisahuvipuisto.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
sisustamessut.fi | https://kevatmessut.messukeskus.com/ | 2024-06-14 | |
sporttitaivas.fi | https://messukeskus.com/wp-signup.php?new=www.sporttitaivas.... | 2024-06-15 | |
studiamessut.fi | http://studia.messukeskus.com/ | 2024-10-29 | |
suomenmessut.fi | http://messukeskus.com/ | 2025-08-31 | |
suomenmetsamessut.fi | DNS-tietueita ei löytynyt | 2026-07-03 | |
suomenmetsämessut.fi | DNS-tietueita ei löytynyt | 2024-07-03 | |
suomenvideoviestinta.fi | http://www.suomenvideoviestinta.fi/ | 2025-08-24 | |
svv.fi | https://svv.fi/ | 2024-09-04 | |
tanssiviekoon.fi | Vanhentunut 2023-12-22 | ||
teknologia17.fi | Vanhentunut 2019-03-19 | ||
teknologia19.fi | Vanhentunut 2024-03-19 | ||
teknologia21.fi | https://teknologia.messukeskus.com/ | 2024-10-16 | |
teknologia22.fi | DNS-tietueita ei löytynyt | 2024-09-28 | |
teknologia23.fi | DNS-tietueita ei löytynyt | 2025-02-20 | |
teknologiatapahtuma.fi | DNS-tietueita ei löytynyt | 2024-08-16 | |
tempaudu.fi | DNS-tietueita ei löytynyt | 2025-08-14 | |
terveysmessut.fi | DNS-tietueita ei löytynyt | 2025-09-04 | |
terveytesimessut.fi | DNS-tietueita ei löytynyt | 2024-06-08 | |
tooltec.fi | https://teknologia.messukeskus.com/ | 2026-05-08 | |
travelfair.fi | http://www.travelfair.fi/ | 2024-10-06 | |
tsigaboom.fi | https://tsigaboom.messukeskus.com/ | 2024-08-15 | |
turvallisuus2021.fi | Vanhentunut 2023-04-09 | ||
turvallisuusmessut2021.fi | Vanhentunut 2023-04-09 | ||
turvallisuustapahtuma.fi | DNS-tietueita ei löytynyt | 2024-09-27 | |
valomessut.fi | http://www.valomessut.fi/ | 2027-03-30 | |
valotapahtuma.fi | Vanhentunut 2024-03-30 | ||
varipinta.fi | Vanhentunut 2023-09-05 | ||
väripinta.fi | Vanhentunut 2023-09-01 | ||
venemessut.fi | http://vene.messukeskus.com/ | 2025-09-04 | |
vihertek.fi | Vanhentunut 2023-11-04 | ||
viiniexpo.fi | Vanhentunut 2023-09-04 | ||
viiniruoka.fi | http://www.viiniruoka.fi/ | 2025-04-28 | |
visitmatka.fi | DNS-tietueita ei löytynyt | 2025-08-31 | |
winterexpo.fi | Vanhentunut 2023-10-17 | ||
woodexpo.fi | Vanhentunut 2023-11-18 | ||
ymparistomessut.fi | Vanhentunut 2023-09-05 | ||
ympäristömessut.fi | Vanhentunut 2023-09-01 | ||
ymparistotekniikkamessut.fi | http://www.ymparistotekniikkamessut.fi/ | 2024-06-06 | |
ympäristötekniikkamessut.fi | https://messukeskus.com/wp-signup.php?new=www.xn--ympristtek... | 2024-06-06 | |
yritys2017.fi | Vanhentunut 2021-02-03 | ||
yritys2018.fi | DNS-tietueita ei löytynyt | 2027-01-26 |