outdoorexpo.fi
Yksityiskohdat
Lähde: Liikenne- ja viestintävirasto (Traficom) ja Internet Assched Numbers Authority (IANA)| Tila | Registered |
| Omistaja | PL 21, Finland |
| Apurahan myöntämispäivä | 2022-12-16 |
| Viimeinen voimassaolopäivä | 2024-12-16 |
| Kirjaaja | Louhi Net Oy 00521 Helsinki |
| Nimipalvelimet Katso lisätietoja DNS-osiosta | dns1.louhi.net dns2.louhi.net dns3.louhi.fi |
| Onko DNSSec käytössä | No |
| IANA-yksityiskohdat jälkiliitteelle | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Palvelimen IP-sijainti
Lähde: Varsinainen verkkosivu - Aikaleima: 2022-05-08 12:02VAROITUS: Huomaa, että sijainti voi olla täysin väärä, jos palvelin käyttää esimerkiksi käänteinen välityspalvelin, kuten Cloudflare
| IP source | IP address | ASN block data | IP Geolocation |
|---|---|---|---|
| Käyttäjän IP | 18.117.183.172 | Tätä ei ole toistaiseksi haettu | Country: United States (US) City: Postal code: Latitude: 37,751 Longitude: -97,822 Network: 18.116.0.0/14 |
| Palvelimen IP osoite | Autonomous System (AS) #: 5517 BGP prefix: 159.25.0.0/16 Country Code: DE Registry: ripencc Allocated: 1992-03-02 Tiedot: CSL, DE | Country: Germany (DE) City: Postal code: Latitude: 51,2993 Longitude: 9,491 Network: 159.25.0.0/16 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Sanapilvi outdoorexpo.fi
Valitettavasti tällä hetkellä ei ole tarpeeksi tietoa sanapilven jäsentämiseksi tälle sivustolle
Verkkosivun tiedot outdoorexpo.fi
Lähde: Varsinainen verkkosivu - Aikaleima: 2022-06-14 21:52| Otsikkotiedot ja sisällönkuvauskentät | title www.outdoorexpo.fi |
| Open Graph (OG) sisällönkuvauskentät | Avoimen graafin tunnisteiden käyttöä suositellaan erittäin hyvin hakukoneoptimoinnissa |
| Twitter-kortit | Twitter-tunnisteiden käyttäminen on erittäin suositeltavaa hakukoneoptimoinnissa (SEO) |
| CSS-tyylisivut (CSS) | |
| Sosiaalisen median (SOME) -linkit | Sosiaalisen median sisällön käyttäminen on erittäin suositeltavaa hakukoneoptimoinnille (SEO) |
| JavaScript-kirjastot |
Evästeen tiedot outdoorexpo.fi
Lähde: Varsinainen verkkosivu - Aikaleima: 2022-06-14 21:52Evästeiden lukumäärä: 0
| Evästeen verkkotunnus | Evästeiden arvot |
|---|
Näyttökuva outdoorexpo.fi
Lähde: Varsinainen verkkosivu - Aikaleima: 2022-05-08 12:02
DNS-tietueet verkkotunnukselle outdoorexpo.fi
Lähde: DNS-vastaus - Aikaleima: 2022-05-08 12:02| A | outdoorexpo.fi 159.25.17.100 (Time to Live: 3600) |
| NS | z.ns.joker.com
|
| SOA | outdoorexpo.fi x.ns.joker.com (Time to Live: 21600) hostmaster.joker.com |
Whois tallentaa historiaa outdoorexpo.fi
Lähde: Liikenne- ja viestintävirasto (Traficom)Näytetään viimeisin max 5 havaitut muutokset tietueissa. Muutokset on korostettu
| Päivämäärä | 2021-06-16 | 2021-06-19 | 2022-06-16 | 2022-12-17 | 2023-11-10 |
|---|---|---|---|---|---|
| Name | outdoorexpo.fi | outdoorexpo.fi | outdoorexpo.fi | outdoorexpo.fi | outdoorexpo.fi |
| State | Validity expired | Registered | Validity expired | Registered | Registered |
| Holder | Sevent Oy | Sevent Oy | Sevent Oy | Suomen Messut Oyj | Suomen Messut Oyj |
| Address | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | PL 21 | PL 21 |
| Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
| GrantDate | 2010-06-15T10:51:04 | 2010-06-15T10:51:04 | 2010-06-15T10:51:04 | 2022-12-16T08:34:17.043 | 2022-12-16T08:34:17.043 |
| Registrar | CSL Computer Service Langenbach GmbH (d/b/a joker.com) | CSL Computer Service Langenbach GmbH (d/b/a joker.com) | CSL Computer Service Langenbach GmbH (d/b/a joker.com) | Louhi Net Oy | Louhi Net Oy |
| PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
| PostalCode | 00520 | 00520 | 00520 | 00521 | 00521 |
| NameServer1 | x.ns.joker.com | x.ns.joker.com | x.ns.joker.com | dns1.louhi.net | dns1.louhi.net |
| NameServer2 | y.ns.joker.com | y.ns.joker.com | y.ns.joker.com | dns2.louhi.net | dns2.louhi.net |
| NameServer3 | z.ns.joker.com | z.ns.joker.com | z.ns.joker.com | dns3.louhi.fi | dns3.louhi.fi |
| PhoneNumber | |||||
| IsDNSSecInUse | yes | yes | yes | no | no |
| OrganizationId | 0942126-6 | 0942126-6 | 0942126-6 | 0116322-3 | 0116322-3 |
| AssociationType | Company | Company | Company | Company | Company |
| LastValidityDate | 2021-06-15T10:51:11 | 2022-06-15T10:51:11 | 2022-06-15T10:51:11 | 2023-12-16T08:34:17.043 | 2024-12-16T08:34:17.043 |
| DepartmentOrContactPerson |
Palvelimen vastaus outdoorexpo.fi
Lähde: Web-palvelimen vastaus - Aikaleima: 2022-05-08 12:02| Lopullinen URL | http://www.outdoorexpo.fi/ |
| HTTP-paluukoodi | HTTP/1.0 200 OK |
| IP-osoite | 159.25.17.100 Autonomous System (AS) #: 5517 BGP prefix: 159.25.0.0/16 Country Code: Germany (DE) Registry: ripencc Allocated: 1992-03-02 Tiedot: CSL, DE |
| Palvelimen otsikko | Palvelin: Redir-httpd Kautta: |
| Sertifikaatti | Ei saatavilla Sertifikaatin käyttö on erittäin suositeltavaa hakukoneoptimoinnissa (SEO) Jos verkkosivustollasi on sertifikaatti ja näet edelleen tämän varoituksen,niin se tarkoittaa sitä että Web-palvelinta ei ole määritetty oikein ohjaamaan liikennettä https-osoitteeseen |
Käytetty tekniikka outdoorexpo.fi
Lähde: Verkkosivujen analyysi - Aikaleima: 2022-05-08 12:02| Uusin arvostelu | 2022-05-08 12:02 |
| Sivun kieli (otsikosta) | (Tämä on usein vääriä!) |
| Teknologiat |  Apache (Web Servers) (100% propable) |
Tunnetut aliverkkotunnukset outdoorexpo.fi
Lähde: Hakukoneet ja DNS-tietueet (VAROITUS: Suurin osa ei välttämättä ole tavoitettavissa (sisäinen / DMZ / vanhentunut)). Näytetään enimmäisrivit 700Löydettyjen aliverkkotunnusten lukumäärä: 2
| Subdomain | IP-osoite |
|---|---|
| mail.outdoorexpo.fi | 188.226.175.50 |
| www.outdoorexpo.fi | 188.226.175.50 |
Web-palveluntarjoajat
Lähde: Kaikki voimassa olevat yrityssivustot, joissa on sisältöä (katso taulukko alla)
Saman omistajan omistamat verkkotunnukset (nykyinen ja aiempi)
Lähde: Liikenne- ja viestintävirasto (Traficom)Verkkotunnusten lukumäärä: 282
| Verkkotunnus | Lopullinen URL (kun viimeksi testattu) | Linkit | Viimeinen voimassaoloaika |
|---|---|---|---|
| 100ideaakevaaseen.fi | Vanhentunut 2023-01-27 | ||
| 55plus.fi | DNS-tietueita ei löytynyt | 2025-02-09 | |
| agriexpo.fi | Vanhentunut 2023-11-23 | ||
| agrikone.fi | Vanhentunut 2023-11-23 | ||
| agrikonemessut.fi | Vanhentunut 2023-11-23 | ||
| agrimessut.fi | Vanhentunut 2023-11-23 | ||
| antiikkitapahtuma.fi | http://antiikki.messukeskus.com/ | 2024-11-27 | |
| apconfinland.fi | Vanhentunut 2021-08-16 | ||
| arenaexpo.fi | https://arena.messukeskus.com/ | 2024-06-14 | |
| asujaremontoi.fi | DNS-tietueita ei löytynyt | 2024-10-25 | |
| atvmessut.fi | Vanhentunut 2023-03-29 | ||
| auto2017.fi | Vanhentunut 2000-12-31 | ||
| auto2019.fi | http://auto.messukeskus.com/ | 2026-02-08 | |
| auto2020.fi | Vanhentunut 2024-02-08 | ||
| auto2021.fi | Vanhentunut 2024-02-08 | ||
| auto2022.fi | Vanhentunut 2024-02-08 | ||
| autokorjaamomessut.fi | https://autokorjaamo.messukeskus.com/ | 2024-09-20 | |
| automaatiomessut.fi | Vanhentunut 2023-09-20 | ||
| auto-messut.fi | http://auto.messukeskus.com/ | 2025-01-26 | |
| båtmässa.fi | DNS-tietueita ei löytynyt | 2024-09-01 | |
| beautyprocover.fi | http://iloveme.messukeskus.com/beauty-pro/ | 2025-05-03 | |
| beautypromessut.fi | DNS-tietueita ei löytynyt | 2024-12-01 | |
| bioenergyexpo.fi | Vanhentunut 2023-11-18 | ||
| bioproductsexpo.fi | Vanhentunut 2023-11-18 | ||
| bisnespaivat.fi | Vanhentunut 2024-01-03 | ||
| bisnespäivät.fi | https://messukeskus.com/wp-signup.php?new=www.xn--bisnespivt... | 2026-01-03 | |
| bolearenaclub.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
| bolearena.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
| böle.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
| businesstravelforum.fi | https://matka.messukeskus.com/b2b/ | 2024-05-22 | |
| caravanmessut.fi | https://caravan.messukeskus.com/ | 2024-09-20 | |
| chembiofinland.fi | http://chembio.messukeskus.com/ | 2025-02-19 | |
| congresscenter.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
| congresscentre.fi | Vanhentunut 2023-09-05 | ||
| conventioncenter.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
| conventioncentre.fi | https://messukeskus.com/wp-signup.php?new=www.conventioncent... | 2027-06-13 | |
| corefair.fi | Vanhentunut 2018-04-16 | ||
| coremessut.fi | Vanhentunut 2018-04-16 | ||
| digiexpo.fi | Vanhentunut 2024-02-19 | ||
| educafair.fi | DNS-tietueita ei löytynyt | 2024-10-28 | |
| educamessut.fi | DNS-tietueita ei löytynyt | 2025-04-07 | |
| elainystavani.fi | DNS-tietueita ei löytynyt | 2025-05-20 | |
| eläinystäväni.fi | DNS-tietueita ei löytynyt | 2025-05-20 | |
| elmamessut.fi | https://elma.messukeskus.com/ | 2024-09-05 | |
| eltekmessut.fi | Vanhentunut 2023-09-04 | ||
| emessukeskus.fi | http://www.emessukeskus.fi/ | 2025-03-27 | |
| enviroexpo.fi | Vanhentunut 2024-01-29 | ||
| facetoface.fi | Vanhentunut 2023-09-07 | ||
| fairnet.fi | Vanhentunut 2023-09-04 | ||
| fillarimessut.fi | https://goexpo.messukeskus.com/ | 2024-09-05 | |
| finlandsmassa.fi | Vanhentunut 2023-09-04 | ||
| finlandsmässa.fi | Vanhentunut 2023-09-01 | ||
| finnbuild.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
| finnexpo.fi | Vanhentunut 2023-08-31 | ||
| finnishdentalexhibition.fi | DNS-tietueita ei löytynyt | 2024-11-17 | |
| finnishfaircorporation.fi | https://messukeskus.com/wp-signup.php?new=www.finnishfaircor... | 2024-09-04 | |
| finnsec.fi | http://www.finnsec.fi/ | 2024-09-04 | |
| foodtechelsinki.fi | https://pfsptec.messukeskus.com/ | 2025-04-07 | |
| formakevat.fi | Vanhentunut 2023-09-03 | ||
| formakevät.fi | Vanhentunut 2023-09-03 | ||
| formasyksy.fi | Vanhentunut 2023-09-03 | ||
| funexpo.fi | http://www.funexpo.fi/ | 2024-09-28 | |
| gamexpo.fi | Vanhentunut 2023-11-17 | ||
| gastro.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
| gastrohelsinki.fi | DNS-tietueita ei löytynyt | 2025-03-20 | |
| gastropro.fi | https://gastro.messukeskus.com/ | 2024-11-01 | |
| globalworkshop.fi | https://matka.messukeskus.com/ | 2024-10-25 | |
| goexpo.fi | https://goexpo.messukeskus.com/ | 2025-12-04 | |
| goexpohorse.fi | Vanhentunut 2023-12-06 | ||
| goexpowinter.fi | Vanhentunut 2023-10-17 | ||
| golfexpo.fi | Vanhentunut 2024-03-05 | ||
| golfmessut.fi | https://golfmessut.fi/ | 2024-09-05 | |
| graftec.fi | Vanhentunut 2024-04-22 | ||
| growthhelsinki.fi | Vanhentunut 2023-02-07 | ||
| gswpro.fi | Vanhentunut 2000-12-31 | ||
| habitare.fi | DNS-tietueita ei löytynyt | 2024-08-31 | |
| habitarepro.fi | http://www.habitarepro.fi/ | 2024-09-22 | |
| hammalääkäripäivätnäyttely.fi | Vanhentunut 2018-11-15 | ||
| hammaslaakaripaivatnayttely.fi | DNS-tietueita ei löytynyt | 2024-11-15 | |
| hammaslääkäripäivätnäyttely.fi | https://hammaslaakaripaivat.messukeskus.com/ | 2024-11-25 | |
| helsingforsbokmassa.fi | https://kirjamessut.messukeskus.com/?lang=sv | 2024-09-05 | |
| helsingforsbokmässa.fi | https://messukeskus.com/wp-signup.php?new=www.xn--helsingfor... | 2024-09-01 | |
| helsingforsmasscentrum.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
| helsingforsmässcentrum.fi | Vanhentunut 2019-09-01 | ||
| helsingineramessut.fi | DNS-tietueita ei löytynyt | 2025-04-19 | |
| helsinginerämessut.fi | DNS-tietueita ei löytynyt | 2025-04-19 | |
| helsinginkirjamessut.fi | https://kirjamessut.messukeskus.com/ | 2024-09-05 | |
| helsinginmessukeskus.fi | DNS-tietueita ei löytynyt | 2024-08-31 | |
| helsinginmessut.fi | http://www.wanhasatama.com/ | 2024-08-31 | |
| helsinginmetsamessut.fi | Vanhentunut 2024-01-08 | ||
| helsinginmetsämessut.fi | Vanhentunut 2024-01-08 | ||
| helsinginmusiikkimessut.fi | Vanhentunut 2023-10-22 | ||
| helsinkiboatshow.fi | DNS-tietueita ei löytynyt | 2024-11-17 | |
| helsinkibookfair.fi | DNS-tietueita ei löytynyt | 2024-09-05 | |
| helsinkicf.fi | DNS-tietueita ei löytynyt | 2025-04-07 | |
| helsinkiconventioncenter.fi | DNS-tietueita ei löytynyt | 2025-06-13 | |
| helsinkiconventioncentre.fi | DNS-tietueita ei löytynyt | 2025-06-13 | |
| helsinkiexhibitionandconventioncenter.fi | https://messukeskus.com/?lang=en | 2025-06-13 | |
| helsinkiexhibitionandconventioncentre.fi | http://www.helsinkiexhibitionandconventioncentre.fi/ | 2025-06-13 | |
| helsinkiexhibitioncenter.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
| helsinkiexhibitioncentre.fi | DNS-tietueita ei löytynyt | 2025-06-13 | |
| helsinkifaircentre.fi | http://messukeskus.com/?lang=en | 2024-09-04 | |
| helsinkihorsefair.fi | http://www.helsinkihorsefair.fi/ | 2024-09-20 | |
| highendhelsinki.fi | Vanhentunut 2024-01-18 | ||
| highendhifi.fi | Vanhentunut 2024-01-16 | ||
| himss.fi | DNS-tietueita ei löytynyt | 2024-11-16 | |
| horsefair.fi | Vanhentunut 2024-04-23 | ||
| hpmessut.fi | http://www.hpmessut.fi/ | 2024-06-07 | |
| hupicon.fi | DNS-tietueita ei löytynyt | 2024-10-06 | |
| iloveme.fi | http://iloveme.messukeskus.com/ | 2025-01-18 | |
| infraexpo.fi | Vanhentunut 2024-01-31 | ||
| jatevesiymparisto.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
| jätevesiympäristö.fi | http://www.xn--jtevesiymprist-5hbj42a.fi/ | 2024-09-04 | |
| jewelandwatch.fi | Vanhentunut 2023-11-27 | ||
| jobforum.fi | Vanhentunut 2023-10-22 | ||
| jointec.fi | Vanhentunut 2024-04-24 | ||
| jonnela.fi | DNS-tietueita ei löytynyt | 2024-10-30 | |
| jonnelaklubi.fi | DNS-tietueita ei löytynyt | 2024-10-30 | |
| julkinenateria.fi | https://ateria.messukeskus.com/ | 2024-11-25 | |
| julkisivumessut.fi | Vanhentunut 2019-01-18 | ||
| kadentaitotapahtuma.fi | Vanhentunut 2024-02-26 | ||
| kädentaitotapahtuma.fi | Vanhentunut 2024-02-26 | ||
| kauneusmessut.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
| kevaanmerkit.fi | Vanhentunut 2024-03-30 | ||
| keväänmerkit.fi | Vanhentunut 2024-03-30 | ||
| kevatmessut.fi | http://www.kevatmessut.fi/ | 2025-01-08 | |
| kevätmessut.fi | http://www.xn--kevtmessut-s5a.fi/ | 2025-01-08 | |
| kevatpuutarha.fi | http://kevatmessut.messukeskus.com/ | 2024-09-04 | |
| kiinteistoklusteri.fi | Vanhentunut 2024-03-29 | ||
| kiinteistöklusteri.fi | Vanhentunut 2024-03-29 | ||
| kiinteistomessut.fi | http://www.kiinteistomessut.fi/ | 2024-09-20 | |
| kiinteistömessut.fi | DNS-tietueita ei löytynyt | 2024-09-01 | |
| kiinteistoplusturvallisuus.fi | Vanhentunut 2024-03-05 | ||
| kiinteistöplusturvallisuus.fi | Vanhentunut 2024-03-05 | ||
| kokoustamo.fi | Vanhentunut 2023-09-25 | ||
| korjausjarakentaminen.fi | Vanhentunut 2023-09-07 | ||
| korjausrakentaminen2018.fi | Vanhentunut 2023-10-04 | ||
| korujakello.fi | Vanhentunut 2023-11-27 | ||
| korujakellomessut.fi | Vanhentunut 2023-11-27 | ||
| kuljetuslogistiikka.fi | Vanhentunut 2023-09-05 | ||
| kutsutapahtumaan.fi | DNS-tietueita ei löytynyt | 2024-10-25 | |
| laakaripaivatnayttely.fi | https://laakaripaivat.messukeskus.com/ | 2024-09-20 | |
| lääkäripäivätnäyttely.fi | DNS-tietueita ei löytynyt | 2025-09-01 | |
| lahiruokaluomu.fi | https://lahiruokajaluomu.messukeskus.com/ | 2024-09-21 | |
| lähiruokaluomu.fi | https://kevatmessut.messukeskus.com/ | 2024-09-21 | |
| lapsimessut.fi | https://lapsimessut.messukeskus.com/ | 2024-09-05 | |
| lautasella.fi | DNS-tietueita ei löytynyt | 2025-06-08 | |
| lemmikkitapahtuma.fi | DNS-tietueita ei löytynyt | 2024-12-16 | |
| liikelahjamessut.fi | Vanhentunut 2019-10-30 | ||
| liikelahjatmessut.fi | Vanhentunut 2019-10-30 | ||
| logistiikkakuljetus.fi | Vanhentunut 2023-09-05 | ||
| maatalouskonemessut.fi | https://maatalouskone.messukeskus.com/ | 2024-11-23 | |
| maintec.fi | Vanhentunut 2018-04-22 | ||
| manufacturingmaterials.fi | Vanhentunut 2023-10-30 | ||
| markkinoinninviikko.fi | Vanhentunut 2024-03-09 | ||
| matkahuutokauppa.fi | Vanhentunut 2019-12-13 | ||
| matkailupalkinto.fi | Vanhentunut 2018-11-30 | ||
| matkamessut.fi | DNS-tietueita ei löytynyt | 2024-09-05 | |
| matkapro.fi | DNS-tietueita ei löytynyt | 2024-11-20 | |
| maxpo.fi | http://www.maxpo.fi/ | 2024-09-04 | |
| mecatec.fi | Vanhentunut 2023-08-31 | ||
| meetfinland.fi | DNS-tietueita ei löytynyt | 2024-09-28 | |
| meidanviikonloppu.fi | Vanhentunut 2024-02-18 | ||
| meidänviikonloppu.fi | Vanhentunut 2024-02-18 | ||
| mesoaja.fi | http://www.mesoaja.fi/ | 2024-07-31 | |
| messuhelmi.fi | Vanhentunut 2018-05-29 | ||
| messukeskus100.fi | Vanhentunut 2023-11-20 | ||
| messukeskushelsinki.fi | DNS-tietueita ei löytynyt | 2024-10-10 | |
| messukirppis.fi | Vanhentunut 2019-02-06 | ||
| messuklubi.fi | DNS-tietueita ei löytynyt | 2024-09-18 | |
| messukutsu.fi | DNS-tietueita ei löytynyt | 2024-05-22 | |
| messumedia.fi | http://www.messumedia.fi/ | 2024-09-04 | |
| messuparkki.fi | DNS-tietueita ei löytynyt | 2025-05-29 | |
| messut100.fi | DNS-tietueita ei löytynyt | 2025-12-13 | |
| messutapahtumat.fi | DNS-tietueita ei löytynyt | 2024-09-20 | |
| messuvalmennus.fi | DNS-tietueita ei löytynyt | 2025-01-14 | |
| metsamessut.fi | https://metsa.messukeskus.com/ | 2025-05-16 | |
| metsämessut.fi | DNS-tietueita ei löytynyt | 2024-05-16 | |
| metsastysmessut.fi | Vanhentunut 2024-04-22 | ||
| metsästysmessut.fi | Vanhentunut 2019-04-22 | ||
| model-expo.fi | Vanhentunut 2023-10-14 | ||
| modelexpo.fi | Vanhentunut 2023-10-14 | ||
| moottorikelkkamessut.fi | Vanhentunut 2024-03-29 | ||
| moottoripyoranayttely.fi | Vanhentunut 2024-02-19 | ||
| moottoripyöränäyttely.fi | DNS-tietueita ei löytynyt | 2024-09-01 | |
| motokuume.fi | http://www.motokuume.fi/ | 2024-12-04 | |
| motokuumemittari.fi | Vanhentunut 2024-01-21 | ||
| mp-messut.fi | DNS-tietueita ei löytynyt | 2024-09-29 | |
| mpmessut.fi | http://mp.messukeskus.com/ | 2025-02-21 | |
| mp-nayttely.fi | http://www.mp-nayttely.fi/ | 2025-02-19 | |
| mprock.fi | Vanhentunut 2023-06-21 | ||
| mpstars.fi | Vanhentunut 2023-11-02 | ||
| muotimessut.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
| nayttely.fi | Vanhentunut 2023-09-05 | ||
| nbe.fi | Vanhentunut 2023-09-11 | ||
| nordictravelfair.fi | http://matka.messukeskus.com/?lang=en | 2024-10-06 | |
| oispatalvi.fi | http://www.oispatalvi.fi/ | 2024-09-14 | |
| omakotimessut.fi | http://kevatmessut.messukeskus.com/ | 2024-09-20 | |
| omamokki.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
| omamökki.fi | DNS-tietueita ei löytynyt | 2024-09-01 | |
| omapiha.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
| onseala.fi | DNS-tietueita ei löytynyt | 2025-03-21 | |
| outdoorexpo.fi | http://www.outdoorexpo.fi/ | 2024-12-16 | |
| pactec.fi | DNS-tietueita ei löytynyt | 2024-08-31 | |
| petrolcircus.fi | DNS-tietueita ei löytynyt | 2024-11-17 | |
| plastexpo.fi | Vanhentunut 2023-09-24 | ||
| pomppulinnataivas.fi | Vanhentunut 2023-10-25 | ||
| pranabeats.fi | Vanhentunut 2019-10-13 | ||
| pratkakuume.fi | Vanhentunut 2018-06-08 | ||
| promoexpo.fi | Vanhentunut 2023-11-21 | ||
| pulpandbeyond.fi | DNS-tietueita ei löytynyt | 2025-05-11 | |
| pulpaper.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
| pwaexpo.fi | Vanhentunut 2021-04-27 | ||
| pwa.fi | Vanhentunut 2024-04-27 | ||
| reset16.fi | Vanhentunut 2020-01-29 | ||
| reset17.fi | Vanhentunut 2019-08-18 | ||
| reset2017.fi | Vanhentunut 2019-08-17 | ||
| retkimessut.fi | Vanhentunut 2024-02-19 | ||
| robtec.fi | Vanhentunut 2000-12-31 | ||
| ruokamessuthelsinki.fi | DNS-tietueita ei löytynyt | 2025-01-09 | |
| sahko-electricity.fi | DNS-tietueita ei löytynyt | 2025-03-25 | |
| sähkö-electricity.fi | DNS-tietueita ei löytynyt | 2025-03-25 | |
| sahkoexpo.fi | http://www.sahkoexpo.fi/ | 2025-03-25 | |
| sähköexpo.fi | DNS-tietueita ei löytynyt | 2025-03-25 | |
| sähkömessut.fi | DNS-tietueita ei löytynyt | 2025-02-15 | |
| sairaanhoitajapaivatnayttely.fi | DNS-tietueita ei löytynyt | 2025-04-20 | |
| sairaanhoitajapäivätnäyttely.fi | DNS-tietueita ei löytynyt | 2025-04-20 | |
| seatechelsinki.fi | Vanhentunut 2000-12-31 | ||
| secd-day.fi | DNS-tietueita ei löytynyt | 2025-02-19 | |
| seonala.fi | DNS-tietueita ei löytynyt | 2025-04-19 | |
| showroomfair.fi | Vanhentunut 2023-11-23 | ||
| signtec.fi | Vanhentunut 2024-01-29 | ||
| sihteeriassistenttimessut.fi | Vanhentunut 2023-10-30 | ||
| sihteeriassistenttipaivat.fi | Vanhentunut 2023-10-30 | ||
| sihteeriassistenttipäivät.fi | Vanhentunut 2023-10-30 | ||
| sijoittaja23.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
| sijoittaja25.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
| sijoittaja26.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
| sijoittaja27.fi | DNS-tietueita ei löytynyt | 2025-05-15 | |
| sijoittajamessut.fi | https://sijoittajamessut.messukeskus.com/ | 2025-01-08 | |
| sisahuvipuisto.fi | DNS-tietueita ei löytynyt | 2024-06-13 | |
| sisustamessut.fi | https://kevatmessut.messukeskus.com/ | 2024-06-14 | |
| sporttitaivas.fi | https://messukeskus.com/wp-signup.php?new=www.sporttitaivas.... | 2024-06-15 | |
| studiamessut.fi | http://studia.messukeskus.com/ | 2024-10-29 | |
| suomenmessut.fi | http://messukeskus.com/ | 2024-08-31 | |
| suomenmetsamessut.fi | DNS-tietueita ei löytynyt | 2025-07-03 | |
| suomenmetsämessut.fi | DNS-tietueita ei löytynyt | 2024-07-03 | |
| suomenvideoviestinta.fi | http://www.suomenvideoviestinta.fi/ | 2024-08-24 | |
| svv.fi | https://svv.fi/ | 2024-09-04 | |
| tanssiviekoon.fi | Vanhentunut 2023-12-22 | ||
| teknologia17.fi | Vanhentunut 2019-03-19 | ||
| teknologia19.fi | Vanhentunut 2024-03-19 | ||
| teknologia21.fi | https://teknologia.messukeskus.com/ | 2024-10-16 | |
| teknologia22.fi | DNS-tietueita ei löytynyt | 2024-09-28 | |
| teknologia23.fi | DNS-tietueita ei löytynyt | 2025-02-20 | |
| teknologiatapahtuma.fi | DNS-tietueita ei löytynyt | 2024-08-16 | |
| tempaudu.fi | DNS-tietueita ei löytynyt | 2024-08-14 | |
| terveysmessut.fi | DNS-tietueita ei löytynyt | 2024-09-04 | |
| terveytesimessut.fi | DNS-tietueita ei löytynyt | 2024-06-08 | |
| tooltec.fi | https://teknologia.messukeskus.com/ | 2026-05-08 | |
| travelfair.fi | http://www.travelfair.fi/ | 2024-10-06 | |
| tsigaboom.fi | https://tsigaboom.messukeskus.com/ | 2024-08-15 | |
| turvallisuus2021.fi | Vanhentunut 2023-04-09 | ||
| turvallisuusmessut2021.fi | Vanhentunut 2023-04-09 | ||
| turvallisuustapahtuma.fi | DNS-tietueita ei löytynyt | 2024-09-27 | |
| valomessut.fi | http://www.valomessut.fi/ | 2027-03-30 | |
| valotapahtuma.fi | Vanhentunut 2024-03-30 | ||
| varipinta.fi | Vanhentunut 2023-09-05 | ||
| väripinta.fi | Vanhentunut 2023-09-01 | ||
| venemessut.fi | http://vene.messukeskus.com/ | 2024-09-04 | |
| vihertek.fi | Vanhentunut 2023-11-04 | ||
| viiniexpo.fi | Vanhentunut 2023-09-04 | ||
| viiniruoka.fi | http://www.viiniruoka.fi/ | 2025-04-28 | |
| visitmatka.fi | DNS-tietueita ei löytynyt | 2024-08-31 | |
| winterexpo.fi | Vanhentunut 2023-10-17 | ||
| woodexpo.fi | Vanhentunut 2023-11-18 | ||
| ymparistomessut.fi | Vanhentunut 2023-09-05 | ||
| ympäristömessut.fi | Vanhentunut 2023-09-01 | ||
| ymparistotekniikkamessut.fi | http://www.ymparistotekniikkamessut.fi/ | 2024-06-06 | |
| ympäristötekniikkamessut.fi | https://messukeskus.com/wp-signup.php?new=www.xn--ympristtek... | 2024-06-06 | |
| yritys2017.fi | Vanhentunut 2021-02-03 | ||
| yritys2018.fi | DNS-tietueita ei löytynyt | 2027-01-26 |