pirkanmaanmetallinkierrätys.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)State | Registered |
Holder | Koivukatu 8, Finland |
Grant Date | 2012-03-15 |
Last Validity Date | 2025-03-15 |
Registrar | Netsplit ry 37830 Viiala |
Name Servers Please see DNS section for details | abby.ns.cloudflare.com woz.ns.cloudflare.com |
Is The DNSSec in Use | Yes |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-12-03 05:26WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP source | IP address | ASN block data | IP Geolocation |
---|---|---|---|
User IP | 18.227.190.120 | This is not retrieved for now | Country: United States (US) State: Ohio (OH) City: Columbus Postal code: 43215 Latitude: 39.9653 Longitude: -83.0235 Network: 18.224.0.0/14 |
Server IP | Autonomous System (AS) #: 13335 BGP prefix: 172.67.192.0/20 Country Code: US Registry: arin Allocated: 2015-02-25 Info: CLOUDFLARENET, US | Country: United States (US) City: Postal code: Latitude: 37.751 Longitude: -97.822 Network: 172.64.0.0/14 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud for pirkanmaanmetallinkierrätys.fi
Sorry, not enough data to parse a word cloud for this site at this time
Web page details for pirkanmaanmetallinkierrätys.fi
Source: Actual web page - Timestamp: 2022-12-02 15:24Header data & Meta tags | title 404 Not Found |
Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
Cascading Style Sheets (CSS) (CSS) | |
Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
JavaScript libraries |
Cookie data for pirkanmaanmetallinkierrätys.fi
Source: Actual web page - Timestamp: 2022-12-02 15:24Number of cookies: 0
Cookie domain | Cookie values |
---|
Screenshot for pirkanmaanmetallinkierrätys.fi
Source: Actual web page - Timestamp: 2022-12-03 05:26
DNS records for pirkanmaanmetallinkierrätys.fi
Source: DNS reponse - Timestamp: 2022-12-03 05:26A | xn--pirkanmaanmetallinkierrtys-2hc.fi 104.21.22.84 (Time to Live: 300) xn--pirkanmaanmetallinkierrtys-2hc.fi 172.67.203.124 (Time to Live: 300) |
AAAA | xn--pirkanmaanmetallinkierrtys-2hc.fi 2606:4700:3030::ac43:cb7c (Time to Live: 300) xn--pirkanmaanmetallinkierrtys-2hc.fi 2606:4700:3037::6815:1654 (Time to Live: 300) |
NS | abby.ns.cloudflare.com
|
SOA | xn--pirkanmaanmetallinkierrtys-2hc.fi abby.ns.cloudflare.com (Time to Live: 3600) dns.cloudflare.com |
TXT | SPF records: v=spf1 include:_spf.google.com -all |
Whois record history for pirkanmaanmetallinkierrätys.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date | 2021-01-19 | 2021-03-16 | 2022-03-04 | 2023-03-16 | 2024-03-16 |
---|---|---|---|---|---|
Name | pirkanmaanmetallinkierrätys.fi | pirkanmaanmetallinkierrätys.fi | pirkanmaanmetallinkierrätys.fi | pirkanmaanmetallinkierrätys.fi | pirkanmaanmetallinkierrätys.fi |
State | Registered | Registered | Registered | Registered | Registered |
Holder | Pirkanmaan Metallinkierrätys Oy | Pirkanmaan Metallinkierrätys Oy | Pirkanmaan Metallinkierrätys Oy | Pirkanmaan Metallinkierrätys Oy | Pirkanmaan Metallinkierrätys Oy |
Address | Koivukatu 8 | Koivukatu 8 | Koivukatu 8 | Koivukatu 8 | Koivukatu 8 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2012-03-15T17:32:03 | 2012-03-15T17:32:03 | 2012-03-15T17:32:03 | 2012-03-15T17:32:03 | 2012-03-15T17:32:03 |
Registrar | Netsplit ry | Netsplit ry | Netsplit ry | Netsplit ry | Netsplit ry |
PostalArea | Viiala | Viiala | Viiala | Viiala | Viiala |
PostalCode | 37830 | 37830 | 37830 | 37830 | 37830 |
NameServer1 | abby.ns.cloudflare.com | abby.ns.cloudflare.com | abby.ns.cloudflare.com | abby.ns.cloudflare.com | abby.ns.cloudflare.com |
NameServer2 | woz.ns.cloudflare.com | woz.ns.cloudflare.com | woz.ns.cloudflare.com | woz.ns.cloudflare.com | woz.ns.cloudflare.com |
PhoneNumber | |||||
IsDNSSecInUse | yes | yes | yes | yes | yes |
OrganizationId | 2430917-6 | 2430917-6 | 2430917-6 | 2430917-6 | 2430917-6 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2021-03-15T17:32:02 | 2022-03-15T17:32:02 | 2023-03-15T17:32:02 | 2024-03-15T17:32:02 | 2025-03-15T17:32:02 |
DepartmentOrContactPerson |
Server response for pirkanmaanmetallinkierrätys.fi
Source: Web server reponse - Timestamp: 2022-12-03 05:26Final URL | http://www.xn--pirkanmaanmetallinkierrtys-2hc.fi/ |
HTTP Return Code | HTTP/1.1 404 Not Found |
IP Address | 172.67.203.124 Autonomous System (AS) #: 13335 BGP prefix: 172.67.192.0/20 Country Code: United States (US) Registry: arin Allocated: 2015-02-25 Info: CLOUDFLARENET, US |
Server Header | Server: Cloudflare Via: |
Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on pirkanmaanmetallinkierrätys.fi
Source: Web page analysis - Timestamp: 2022-12-03 05:26Latest review | 2022-12-03 05:26 |
Page language (from header) | en (This is often false!) |
Technologies | Fastly (CDN) (100% propable) GitHub Pages (PaaS) (100% propable) Varnish (Cache Tools) (100% propable) jQuery 3.6.0 (JavaScript Libraries) (100% propable) |
Known subdomains for pirkanmaanmetallinkierrätys.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700No subdomains found
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 3
Domain name | Final URL (when last tested) | Links | Last validity |
---|---|---|---|
jjnyman.fi | Expired 2020-06-16 | ||
pirkanmaanmetallinkierratys.fi | https://www.pirkanmaanmetallinkierratys.fi/ | 2025-03-15 | |
pirkanmaanmetallinkierrätys.fi | http://www.xn--pirkanmaanmetallinkierrtys-2hc.fi/ | 2025-03-15 |