pirkanmaanmetallinkierratys.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)| State | Registered |
| Holder | Koivukatu 8, Finland |
| Grant Date | 2012-03-15 |
| Last Validity Date | 2025-03-15 |
| Registrar | Netsplit ry 37830 Viiala |
| Name Servers Please see DNS section for details | abby.ns.cloudflare.com woz.ns.cloudflare.com |
| Is The DNSSec in Use | Yes |
| IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-12-03 13:43WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
| IP source | IP address | ASN block data | IP Geolocation |
|---|---|---|---|
| User IP | 3.148.109.105 | This is not retrieved for now | Country: United States (US) City: Postal code: Latitude: 37.751 Longitude: -97.822 Network: 3.144.0.0/12 |
| Server IP | Autonomous System (AS) #: 13335 BGP prefix: 104.21.32.0/20 Country Code: US Registry: arin Allocated: 2014-03-28 Info: CLOUDFLARENET, US | Country: United States (US) City: Postal code: Latitude: 37.751 Longitude: -97.822 Network: 104.16.0.0/13 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud for pirkanmaanmetallinkierratys.fi
Source: Actual web page - Timestamp: 2022-12-03 13:43Notice: Miscellaneous words removed from the cloud to enhance the analytics
Web page details for pirkanmaanmetallinkierratys.fi
Source: Actual web page - Timestamp: 2022-12-02 16:00| Header data & Meta tags | title Pirkanmaan Metallinkierrätys Oy | raudanluja ammattilainen author Virtuaalitehdas | http://www.virtuaalitehdas.fi/ robots max-image-preview:large iconpath http://www.pirkanmaanmetallinkierratys.fi/wp-content/themes/adventure-journal/images/bh generator WordPress 6.1 not_found empty |
| Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
| Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
| Cascading Style Sheets (CSS) (CSS) | https://www.pirkanmaanmetallinkierratys.fi/wp-includes/css/dist/block-library/style.min.css?ver=6.1 https://www.pirkanmaanmetallinkierratys.fi/wp-includes/css/classic-themes.min.css?ver=1 https://www.pirkanmaanmetallinkierratys.fi/wp-content/themes/adventure-journal/style.css?ver=6.1 |
| Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
| JavaScript libraries |
Cookie data for pirkanmaanmetallinkierratys.fi
Source: Actual web page - Timestamp: 2022-12-02 16:00Number of cookies: 0
| Cookie domain | Cookie values |
|---|
Screenshot for pirkanmaanmetallinkierratys.fi
Source: Actual web page - Timestamp: 2022-12-03 13:43
DNS records for pirkanmaanmetallinkierratys.fi
Source: DNS reponse - Timestamp: 2022-12-03 13:43| A | pirkanmaanmetallinkierratys.fi 104.21.39.172 (Time to Live: 300) pirkanmaanmetallinkierratys.fi 172.67.147.99 (Time to Live: 300) |
| AAAA | pirkanmaanmetallinkierratys.fi 2606:4700:3033::6815:27ac (Time to Live: 300) pirkanmaanmetallinkierratys.fi 2606:4700:3037::ac43:9363 (Time to Live: 300) |
| MX | aspmx3.googlemail.com (Time to Live: 300) aspmx.l.google.com (Time to Live: 300) alt1.aspmx.l.google.com (Time to Live: 300) alt2.aspmx.l.google.com (Time to Live: 300) aspmx2.googlemail.com (Time to Live: 300) |
| NS | woz.ns.cloudflare.com
|
| SOA | pirkanmaanmetallinkierratys.fi abby.ns.cloudflare.com (Time to Live: 3600) dns.cloudflare.com |
| TXT | SPF records: v=spf1 include:_spf.netsplit.fi include:_spf.google.com -all |
Whois record history for pirkanmaanmetallinkierratys.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
| Date | 2021-01-19 | 2021-03-16 | 2022-03-04 | 2023-03-16 | 2024-03-16 |
|---|---|---|---|---|---|
| Name | pirkanmaanmetallinkierratys.fi | pirkanmaanmetallinkierratys.fi | pirkanmaanmetallinkierratys.fi | pirkanmaanmetallinkierratys.fi | pirkanmaanmetallinkierratys.fi |
| State | Registered | Registered | Registered | Registered | Registered |
| Holder | Pirkanmaan Metallinkierrätys Oy | Pirkanmaan Metallinkierrätys Oy | Pirkanmaan Metallinkierrätys Oy | Pirkanmaan Metallinkierrätys Oy | Pirkanmaan Metallinkierrätys Oy |
| Address | Koivukatu 8 | Koivukatu 8 | Koivukatu 8 | Koivukatu 8 | Koivukatu 8 |
| Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
| GrantDate | 2012-03-15T17:32:01 | 2012-03-15T17:32:01 | 2012-03-15T17:32:01 | 2012-03-15T17:32:01 | 2012-03-15T17:32:01 |
| Registrar | Netsplit ry | Netsplit ry | Netsplit ry | Netsplit ry | Netsplit ry |
| PostalArea | Viiala | Viiala | Viiala | Viiala | Viiala |
| PostalCode | 37830 | 37830 | 37830 | 37830 | 37830 |
| NameServer1 | abby.ns.cloudflare.com | abby.ns.cloudflare.com | abby.ns.cloudflare.com | abby.ns.cloudflare.com | abby.ns.cloudflare.com |
| NameServer2 | woz.ns.cloudflare.com | woz.ns.cloudflare.com | woz.ns.cloudflare.com | woz.ns.cloudflare.com | woz.ns.cloudflare.com |
| PhoneNumber | |||||
| IsDNSSecInUse | yes | yes | yes | yes | yes |
| OrganizationId | 2430917-6 | 2430917-6 | 2430917-6 | 2430917-6 | 2430917-6 |
| AssociationType | Company | Company | Company | Company | Company |
| LastValidityDate | 2021-03-15T17:32:01 | 2022-03-15T17:32:01 | 2023-03-15T17:32:01 | 2024-03-15T17:32:01 | 2025-03-15T17:32:01 |
| DepartmentOrContactPerson |
Server response for pirkanmaanmetallinkierratys.fi
Source: Web server reponse - Timestamp: 2022-12-03 13:43| Final URL | https://www.pirkanmaanmetallinkierratys.fi/ |
| HTTP Return Code | HTTP/1.1 200 OK |
| IP Address | 104.21.39.172 Autonomous System (AS) #: 13335 BGP prefix: 104.21.32.0/20 Country Code: United States (US) Registry: arin Allocated: 2014-03-28 Info: CLOUDFLARENET, US |
| Server Header | Server: Cloudflare Via: |
| Certificate | Issued By: Cloudflare, Inc. Issuer details: O=Cloudflare, Inc., United States (US) Issuer details: CN=Cloudflare Inc ECC CA-3 Version: 2 Algorithm: ecdsa-with-SHA256 Issued On: 2022-06-08 00:00:00 Expires On: 2023-06-09 00:00:00 |
| Certificate Subject | Country (C): US Location (L): San Francisco Organization (O): Cloudflare, Inc. Common Name (CN): sni.cloudflaressl.com |
| Certificate Alternative Names | *.pirkanmaanmetallinkierratys.fi sni.cloudflaressl.com pirkanmaanmetallinkierratys.fi |
Used technologies on pirkanmaanmetallinkierratys.fi
Source: Web page analysis - Timestamp: 2022-12-03 13:43| Latest review | 2022-12-03 13:43 |
| Page language (from header) | en (This is often false!) |
| Technologies |  Fastly (CDN) (100% propable) GitHub Pages (PaaS) (100% propable) Varnish (Cache Tools) (100% propable) jQuery 3.6.0 (JavaScript Libraries) (100% propable) |
Known subdomains for pirkanmaanmetallinkierratys.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700No subdomains found
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 3
| Domain name | Final URL (when last tested) | Links | Last validity |
|---|---|---|---|
| jjnyman.fi | Expired 2020-06-16 | ||
| pirkanmaanmetallinkierratys.fi | https://www.pirkanmaanmetallinkierratys.fi/ | 2025-03-15 | |
| pirkanmaanmetallinkierrätys.fi | http://www.xn--pirkanmaanmetallinkierrtys-2hc.fi/ | 2025-03-15 |