jjnyman.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)State | Validity expired |
Holder | Koivukatu 8, Finland +358408159398 |
Grant Date | 2019-06-16 |
Last Validity Date | 2020-06-16 |
Registrar | Netsplit ry 37830 Viiala |
Name Servers Please see DNS section for details | abby.ns.cloudflare.com woz.ns.cloudflare.com |
Is The DNSSec in Use | Yes |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2020-05-30 00:16WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
Server IP not valid or missing details in database. Map not shown
Word cloud for jjnyman.fi
Sorry, not enough data to parse a word cloud for this site at this time
Web page details for jjnyman.fi
Source: Actual web page - Timestamp: Header data & Meta tags | |
Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
Cascading Style Sheets (CSS) (CSS) | |
Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
JavaScript libraries |
Screenshot for jjnyman.fi
DNS records for jjnyman.fi
Source: DNS reponse - Timestamp: 2020-05-30 00:16HINFO | os: cpu: RFC8482 ttl: 3788 host: jjnyman.fi type: HINFO class: IN |
Whois record history for jjnyman.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date | 2019-06-17 | 2020-06-19 |
---|---|---|
Name | jjnyman.fi | jjnyman.fi |
State | Registered | Validity expired |
Holder | Pirkanmaan Metallinkierrätys Oy | Pirkanmaan Metallinkierrätys Oy |
Address | Koivukatu 8 | Koivukatu 8 |
Country | Finland (FI) | Finland (FI) |
GrantDate | 2019-06-16T23:17:44.003 | 2019-06-16T23:17:44.003 |
Registrar | Netsplit ry | Netsplit ry |
PostalArea | Viiala | Viiala |
PostalCode | 37830 | 37830 |
NameServer1 | abby.ns.cloudflare.com | abby.ns.cloudflare.com |
NameServer2 | woz.ns.cloudflare.com | woz.ns.cloudflare.com |
PhoneNumber | +358408159398 | +358408159398 |
IsDNSSecInUse | yes | yes |
OrganizationId | 2430917-6 | 2430917-6 |
AssociationType | Company | Company |
LastValidityDate | 2020-06-16T23:17:44.003 | 2020-06-16T23:17:44.003 |
DepartmentOrContactPerson |
Server response for jjnyman.fi
Source: Web server reponse - Timestamp: 2020-05-30 00:16Final URL | |
HTTP Return Code | |
IP Address | |
Server Header | Server: Via: |
Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on jjnyman.fi
Source: Web page analysis - Timestamp: 2020-05-30 00:16Latest review | 2020-05-30 00:16 |
Page language (from header) | fi (This is often false!) |
Technologies | Apache (Web Servers) (100% propable) Elementor 2.8.3 (Landing Page Builders) (100% propable) Google Analytics (Analytics) (100% propable) RequireJS (JavaScript Frameworks) (100% propable) Swiper Slider (Miscellaneous) (100% propable) Twitter Emoji (Twemoji) (Miscellaneous) (100% propable) WordPress 5.3.3 (CMSBlogs) (100% propable) Yoast SEO 13.3 (SEO) (100% propable) jQuery 1.12.4 (JavaScript Libraries) (100% propable) jQuery Migrate 1.4.1 (JavaScript Libraries) (100% propable) |
Known subdomains for jjnyman.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700No subdomains found
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 3
Domain name | Final URL (when last tested) | Links | Last validity |
---|---|---|---|
jjnyman.fi | Expired 2020-06-16 | ||
pirkanmaanmetallinkierratys.fi | https://www.pirkanmaanmetallinkierratys.fi/ | 2025-03-15 | |
pirkanmaanmetallinkierrätys.fi | http://www.xn--pirkanmaanmetallinkierrtys-2hc.fi/ | 2025-03-15 |