kkt-koulutus.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)State | Registered |
Holder | Vanajantie 4-6 A 3, Finland |
Grant Date | 2021-06-09 |
Last Validity Date | 2024-06-09 |
Registrar | Planeetta Internet Oy 00510 Helsinki |
Name Servers Please see DNS section for details | ns1.domainhotelli.fi ns2.domainhotelli.fi |
Is The DNSSec in Use | No |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-10-22 03:21WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
Server IP not valid or missing details in database. Map not shown
Word cloud for kkt-koulutus.fi
Source: Actual web page - Timestamp: 2022-10-22 03:21Notice: Miscellaneous words removed from the cloud to enhance the analytics
Web page details for kkt-koulutus.fi
Source: Actual web page - Timestamp: 2022-11-29 23:24Header data & Meta tags | title VIRHE: Pyydettyä URL-osoitetta ei voitu hakea not_found Copyright (C) 1996-2019 The Squid Software Foundation and contributorstext/html; charset=utf-8. |
Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
Cascading Style Sheets (CSS) (CSS) | |
Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
JavaScript libraries |
Cookie data for kkt-koulutus.fi
Source: Actual web page - Timestamp: 2022-11-29 23:24Number of cookies: 0
Cookie domain | Cookie values |
---|
Screenshot for kkt-koulutus.fi
Source: Actual web page - Timestamp: 2022-10-22 03:21
DNS records for kkt-koulutus.fi
Source: DNS reponse - Timestamp: 2022-10-22 03:21
Whois record history for kkt-koulutus.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date | 2021-06-09 | 2021-11-22 | 2022-05-22 | 2023-05-25 |
---|---|---|---|---|
Name | kkt-koulutus.fi | kkt-koulutus.fi | kkt-koulutus.fi | kkt-koulutus.fi |
State | Registered | Registered | Registered | Registered |
Holder | WiseMind Psychotherapies & Consulting Oy | WiseMind Psychotherapies & Consulting Oy | WiseMind Psychotherapies & Consulting Oy | WiseMind Psychotherapies & Consulting Oy |
Address | Vanajantie 4-6 A 3 | Vanajantie 4-6 A 3 | Vanajantie 4-6 A 3 | Vanajantie 4-6 A 3 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2021-06-09T21:09:18.657 | 2021-06-09T21:09:18.657 | 2021-06-09T21:09:18.657 | 2021-06-09T21:09:18.657 |
Registrar | Domainhotelli Oy | Planeetta Internet Oy | Planeetta Internet Oy | Planeetta Internet Oy |
PostalArea | Helsinki | Helsinki | Helsinki | Helsinki |
PostalCode | 00510 | 00510 | 00510 | 00510 |
NameServer1 | ns1.domainhotelli.fi | ns1.domainhotelli.fi | ns1.domainhotelli.fi | ns1.domainhotelli.fi |
NameServer2 | ns2.domainhotelli.fi | ns2.domainhotelli.fi | ns2.domainhotelli.fi | ns2.domainhotelli.fi |
PhoneNumber | ||||
IsDNSSecInUse | no | no | no | no |
OrganizationId | 2210044-0 | 2210044-0 | 2210044-0 | 2210044-0 |
AssociationType | Company | Company | Company | Company |
LastValidityDate | 2022-06-09T21:09:18.657 | 2022-06-09T21:09:18.657 | 2023-06-09T21:09:18.657 | 2024-06-09T21:09:18.657 |
DepartmentOrContactPerson |
Server response for kkt-koulutus.fi
Source: Web server reponse - Timestamp: 2022-10-22 03:21Final URL | http://www.kkt-koulutus.fi/ |
HTTP Return Code | |
IP Address | |
Server Header | Server: Via: |
Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on kkt-koulutus.fi
Source: Web page analysis - Timestamp: 2022-10-22 03:21Latest review | 2022-10-22 03:21 |
Page language (from header) | fi (This is often false!) |
Technologies | Apache 2.4.29 (Web Servers) (100% propable) Google Font API (Font Scripts) (100% propable) Lightbox (JavaScript Libraries) (100% propable) PHP (Programming Languages) (100% propable) Pure CSS (UI Frameworks) (100% propable) Ubuntu (Operating Systems) (100% propable) jQuery 1.10.2 (JavaScript Libraries) (100% propable) reCAPTCHA (Captchas) (100% propable) |
Known subdomains for kkt-koulutus.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700No subdomains found
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 24
Domain name | Final URL (when last tested) | Links | Last validity |
---|---|---|---|
abaterapia.fi | http://www.abaterapia.fi/ | 2024-06-09 | |
ahdistuksenhallinta.fi | http://www.ahdistuksenhallinta.fi/ | 2025-07-23 | |
altistus.fi | http://www.altistus.fi/ | 2025-01-05 | |
altistushoito.fi | http://www.altistushoito.fi/ | 2025-07-22 | |
altistustushoito.fi | http://www.altistustushoito.fi/ | 2025-01-05 | |
behaviorlab.fi | http://behaviorlab.fi/ | 2026-05-06 | |
dialektinenkayttaytymisterapia.fi | http://www.dialektinenkayttaytymisterapia.fi/ | 2025-04-03 | |
dkt-koulutus.fi | http://www.dkt-koulutus.fi/ | 2024-06-09 | |
dktkoulutus.fi | http://www.dktkoulutus.fi/ | 2024-06-09 | |
dkt-terapeutit.fi | http://www.dkt-terapeutit.fi/ | 2024-06-09 | |
dkt-yhdistys.fi | https://dkt-yhdistys.fi/ | 2025-10-16 | |
hot-terapia.fi | http://www.hot-terapia.fi/ | 2024-06-09 | |
hyvaksymisjaomistautumisterapia.fi | http://www.hyvaksymisjaomistautumisterapia.fi/ | 2025-07-23 | |
kayttaytymisanalyysi.fi | http://www.kayttaytymisanalyysi.fi/ | 2025-12-28 | |
kayttaytymisterapia.fi | http://www.kayttaytymisterapia.fi/ | 2026-04-05 | |
ketjuanalyysi.fi | http://www.ketjuanalyysi.fi/ | 2024-06-09 | |
kkt-koulutus.fi | http://www.kkt-koulutus.fi/ | 2024-06-09 | |
kognitiivinenterapia.fi | http://www.wisemind.fi/ | 2025-04-08 | |
psykoterapiatakuu.fi | http://www.psykoterapiatakuu.fi/ | 2024-06-09 | |
respondentti.fi | http://www.respondentti.fi/ | 2024-06-09 | |
taitoharjoittelu.fi | http://www.taitoharjoittelu.fi/ | 2025-05-30 | |
terapiakoulutus.fi | http://www.terapiakoulutus.fi/ | 2024-11-05 | |
viisaallamielella.fi | http://www.viisaallamielella.fi/ | 2025-08-15 | |
wisemind.fi | http://www.wisemind.fi/ | 2025-10-06 |