ahdistuksenhallinta.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)State | Registered |
Holder | Vanajantie 4-6 A3, Finland |
Grant Date | 2020-07-23 |
Last Validity Date | 2025-07-23 |
Registrar | Domainkeskus Oy 00510 Helsinki |
Name Servers Please see DNS section for details | ns1.euronic.fi ns2.euronic.fi ns3.euronic.fi |
Is The DNSSec in Use | No |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-09-21 01:25WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
Server IP not valid or missing details in database. Map not shown
Word cloud for ahdistuksenhallinta.fi
Sorry, not enough data to parse a word cloud for this site at this time
Web page details for ahdistuksenhallinta.fi
Source: Actual web page - Timestamp: 2022-11-21 16:30Header data & Meta tags | title VIRHE: Pyydettyä URL-osoitetta ei voitu hakea not_found Copyright (C) 1996-2019 The Squid Software Foundation and contributorstext/html; charset=utf-8. |
Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
Cascading Style Sheets (CSS) (CSS) | |
Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
JavaScript libraries |
Cookie data for ahdistuksenhallinta.fi
Source: Actual web page - Timestamp: 2022-11-21 16:30Number of cookies: 0
Cookie domain | Cookie values |
---|
Screenshot for ahdistuksenhallinta.fi
Source: Actual web page - Timestamp: 2022-09-21 01:25
DNS records for ahdistuksenhallinta.fi
Source: DNS reponse - Timestamp: 2022-09-21 01:25
Whois record history for ahdistuksenhallinta.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date | 2020-07-24 | 2021-01-19 | 2021-07-01 | 2022-01-10 | 2024-07-07 |
---|---|---|---|---|---|
Name | ahdistuksenhallinta.fi | ahdistuksenhallinta.fi | ahdistuksenhallinta.fi | ahdistuksenhallinta.fi | ahdistuksenhallinta.fi |
State | Registered | Registered | Registered | Registered | Registered |
Holder | WiseMind Psychotherapies & Consulting Oy | WiseMind Psychotherapies & Consulting Oy | WiseMind Psychotherapies & Consulting Oy | WiseMind Psychotherapies & Consulting Oy | WiseMind Psychotherapies & Consulting Oy |
Address | Vanajantie 4-6 A3 | Vanajantie 4-6 A3 | Vanajantie 4-6 A3 | Vanajantie 4-6 A3 | Vanajantie 4-6 A3 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2020-07-23T08:12:27.727 | 2020-07-23T08:12:27.727 | 2020-07-23T08:12:27.727 | 2020-07-23T08:12:27.727 | 2020-07-23T08:12:27.727 |
Registrar | Euronic Oy | Euronic Oy | Euronic Oy | Euronic Oy | Domainkeskus Oy |
PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
PostalCode | 00510 | 00510 | 00510 | 00510 | 00510 |
NameServer1 | ns1.euronic.fi | ns1.euronic.fi | ns1.euronic.fi | ns1.euronic.fi | ns1.euronic.fi |
NameServer2 | ns2.euronic.fi | ns2.euronic.fi | ns2.euronic.fi | ns2.euronic.fi | ns2.euronic.fi |
NameServer3 | ns3.euronic.fi | ns3.euronic.fi | ns3.euronic.fi | ns3.euronic.fi | ns3.euronic.fi |
PhoneNumber | +358445015075 | ||||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 2210044-0 | 2210044-0 | 2210044-0 | 2210044-0 | 2210044-0 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2021-07-23T08:12:27.727 | 2021-07-23T08:12:27.727 | 2022-07-23T08:12:27.727 | 2025-07-23T08:12:27.727 | 2025-07-23T08:12:27.727 |
DepartmentOrContactPerson |
Server response for ahdistuksenhallinta.fi
Source: Web server reponse - Timestamp: 2022-09-21 01:25Final URL | http://www.ahdistuksenhallinta.fi/ |
HTTP Return Code | |
IP Address | |
Server Header | Server: Via: |
Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on ahdistuksenhallinta.fi
Source: Web page analysis - Timestamp: 2022-09-21 01:25Latest review | 2022-09-21 01:25 |
Page language (from header) | (This is often false!) |
Technologies |
Known subdomains for ahdistuksenhallinta.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700No subdomains found
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 24
Domain name | Final URL (when last tested) | Links | Last validity |
---|---|---|---|
abaterapia.fi | http://www.abaterapia.fi/ | 2025-06-09 | |
ahdistuksenhallinta.fi | http://www.ahdistuksenhallinta.fi/ | 2025-07-23 | |
altistus.fi | http://www.altistus.fi/ | 2025-01-05 | |
altistushoito.fi | http://www.altistushoito.fi/ | 2025-07-22 | |
altistustushoito.fi | http://www.altistustushoito.fi/ | 2025-01-05 | |
behaviorlab.fi | http://behaviorlab.fi/ | 2026-05-06 | |
dialektinenkayttaytymisterapia.fi | http://www.dialektinenkayttaytymisterapia.fi/ | 2025-04-03 | |
dkt-koulutus.fi | http://www.dkt-koulutus.fi/ | 2025-06-09 | |
dktkoulutus.fi | http://www.dktkoulutus.fi/ | 2025-06-09 | |
dkt-terapeutit.fi | http://www.dkt-terapeutit.fi/ | 2025-06-09 | |
dkt-yhdistys.fi | https://dkt-yhdistys.fi/ | 2025-10-16 | |
hot-terapia.fi | http://www.hot-terapia.fi/ | 2025-06-09 | |
hyvaksymisjaomistautumisterapia.fi | http://www.hyvaksymisjaomistautumisterapia.fi/ | 2025-07-23 | |
kayttaytymisanalyysi.fi | http://www.kayttaytymisanalyysi.fi/ | 2025-12-28 | |
kayttaytymisterapia.fi | http://www.kayttaytymisterapia.fi/ | 2026-04-05 | |
ketjuanalyysi.fi | http://www.ketjuanalyysi.fi/ | 2025-06-09 | |
kkt-koulutus.fi | http://www.kkt-koulutus.fi/ | 2025-06-09 | |
kognitiivinenterapia.fi | http://www.wisemind.fi/ | 2025-04-08 | |
psykoterapiatakuu.fi | http://www.psykoterapiatakuu.fi/ | 2025-06-09 | |
respondentti.fi | http://www.respondentti.fi/ | 2025-06-09 | |
taitoharjoittelu.fi | http://www.taitoharjoittelu.fi/ | 2025-05-30 | |
terapiakoulutus.fi | http://www.terapiakoulutus.fi/ | 2024-11-05 | |
viisaallamielella.fi | http://www.viisaallamielella.fi/ | 2025-08-15 | |
wisemind.fi | http://www.wisemind.fi/ | 2025-10-06 |