kayttaytymisanalyysi.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)State | Registered |
Holder | Vanajantie 4-6 A 3, Finland |
Grant Date | 2010-12-28 |
Last Validity Date | 2025-12-28 |
Registrar | Euronic Oy 00510 Helsinki |
Name Servers Please see DNS section for details | ns1.euronic.fi ns2.euronic.fi ns3.euronic.fi |
Is The DNSSec in Use | No |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-09-01 17:43WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP source | IP address | ASN block data | IP Geolocation |
---|---|---|---|
User IP | 18.223.195.146 | This is not retrieved for now | Country: United States (US) State: Ohio (OH) City: Columbus Postal code: 43215 Latitude: 39.9653 Longitude: -83.0235 Network: 18.223.128.0/17 |
Server IP | Autonomous System (AS) #: 201964 BGP prefix: 31.187.84.0/22 Country Code: FI Registry: ripencc Allocated: 2011-03-25 Info: EURONIC, FI | Country: Finland (FI) State: Uusimaa (18) City: Vantaa Postal code: 01620 Latitude: 60.2799 Longitude: 24.8537 Network: 31.187.84.0/22 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud for kayttaytymisanalyysi.fi
Source: Actual web page - Timestamp: 2022-09-01 17:43Notice: Miscellaneous words removed from the cloud to enhance the analytics
Web page details for kayttaytymisanalyysi.fi
Source: Actual web page - Timestamp: 2022-12-03 19:19Header data & Meta tags | title etusivu viewport initial-scale=1.0, maximum-scale=1.0 generator RapidWeaver not_found text/html; charset=utf-8 |
Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
Cascading Style Sheets (CSS) (CSS) | rw_common/themes/hv_xxlr_right/css/ecfts/12px.css rw_common/themes/hv_xxlr_right/css/blogft/content.css rw_common/themes/hv_xxlr_right/css/menufs/46pxw.css rw_common/themes/hv_xxlr_right/css/sfs/12px.css rw_common/themes/hv_xxlr_right/css/cfts/13px.css index_files/stacks_page_page1.css rw_common/themes/hv_xxlr_right/print.css rw_common/themes/hv_xxlr_right/css/border/hider.css rw_common/themes/hv_xxlr_right/css/bgimage/ontrans25.css rw_common/themes/hv_xxlr_right/css/ec7/off.css rw_common/themes/hv_xxlr_right/css/hfs/76px.css rw_common/themes/hv_xxlr_right/css/mstyle/upp.css rw_common/themes/hv_xxlr_right/css/shadow/off.css rw_common/themes/hv_xxlr_right/css/menuft/economica.css rw_common/plugins/stacks/stacks.css rw_common/themes/hv_xxlr_right/colourtag-page1.css rw_common/themes/hv_xxlr_right/css/cft/century.css rw_common/themes/hv_xxlr_right/css/width/700pxc.css rw_common/themes/hv_xxlr_right/styles.css rw_common/themes/hv_xxlr_right/css/tf/upp.css rw_common/themes/hv_xxlr_right/css/smbg/ontrans0.css rw_common/themes/hv_xxlr_right/css/hft/bebas.css rw_common/themes/hv_xxlr_right/css/sfts/13px.css http://fonts.googleapis.com/css?family=pt+sans+narrow|pt+sans+caption|comfortaa|handlee rw_common/themes/hv_xxlr_right/css/meff/off.css |
Social Media (SOME) links | Twitter: http://twitter.com/share Pinterest: javascript:void((function()%7Bvar%20e=document.createElement('script');e.setAttribute('type','text/javascript');e.setAttribute('charset','UTF-8');e.setAttribute('src','http://assets.pinterest.com/js/pinmarklet.js?r='+Math.random()*99999999);document.body.appendChild(e)%7D)()); |
JavaScript libraries | http://platform.linkedin.com/in.js index_files/stacks_page_page1.js rw_common/themes/hv_xxlr_right/javascript.js https://ajax.googleapis.com/ajax/libs/jquery/1/jquery.min.js rw_common/themes/hv_xxlr_right/scripts/xxl.js https://apis.google.com/js/plusone.js |
Cookie data for kayttaytymisanalyysi.fi
Source: Actual web page - Timestamp: 2022-12-03 19:19Number of cookies: 0
Cookie domain | Cookie values |
---|
Screenshot for kayttaytymisanalyysi.fi
Source: Actual web page - Timestamp: 2022-09-01 17:43
DNS records for kayttaytymisanalyysi.fi
Source: DNS reponse - Timestamp: 2022-09-01 17:43A | kayttaytymisanalyysi.fi 31.187.84.41 (Time to Live: 599) |
MX | mx-in2.euronic.fi (Time to Live: 600) mx-in1.euronic.fi (Time to Live: 600) |
NS | ns3.euronic.fi
|
SOA | kayttaytymisanalyysi.fi ns1.euronic.fi (Time to Live: 600) hostmaster.euronic.fi |
Whois record history for kayttaytymisanalyysi.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date | 2019-12-12 | 2020-12-01 | 2021-01-19 | 2021-12-01 | 2022-01-10 |
---|---|---|---|---|---|
Name | kayttaytymisanalyysi.fi | kayttaytymisanalyysi.fi | kayttaytymisanalyysi.fi | kayttaytymisanalyysi.fi | kayttaytymisanalyysi.fi |
State | Registered | Registered | Registered | Registered | Registered |
Holder | Teemu Ryhänen | Teemu Ryhänen | Teemu Ryhänen | Teemu Ryhänen | Teemu Ryhänen |
Address | Vanajantie 4-6 A 3 | Vanajantie 4-6 A 3 | Vanajantie 4-6 A 3 | Vanajantie 4-6 A 3 | Vanajantie 4-6 A 3 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2010-12-28T13:13:08 | 2010-12-28T13:13:08 | 2010-12-28T13:13:08 | 2010-12-28T13:13:08 | 2010-12-28T13:13:08 |
Registrar | Euronic Oy | Euronic Oy | Euronic Oy | Euronic Oy | Euronic Oy |
PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
PostalCode | 00510 | 00510 | 00510 | 00510 | 00510 |
NameServer1 | ns1.euronic.fi | ns1.euronic.fi | ns1.euronic.fi | ns1.euronic.fi | ns1.euronic.fi |
NameServer2 | ns2.euronic.fi | ns2.euronic.fi | ns2.euronic.fi | ns2.euronic.fi | ns2.euronic.fi |
NameServer3 | ns3.euronic.fi | ns3.euronic.fi | ns3.euronic.fi | ns3.euronic.fi | ns3.euronic.fi |
PhoneNumber | 358445015075 | 358445015075 | |||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 2210044-0 | 2210044-0 | 2210044-0 | 2210044-0 | 2210044-0 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2020-12-28T13:13:08 | 2021-12-28T13:13:08 | 2021-12-28T13:13:08 | 2022-12-28T13:13:08 | 2025-12-28T13:13:08 |
DepartmentOrContactPerson |
Server response for kayttaytymisanalyysi.fi
Source: Web server reponse - Timestamp: 2022-09-01 17:43Final URL | http://www.kayttaytymisanalyysi.fi/ |
HTTP Return Code | HTTP/1.1 200 OK |
IP Address | 31.187.84.41 Autonomous System (AS) #: 201964 BGP prefix: 31.187.84.0/22 Country Code: Finland (FI) Registry: ripencc Allocated: 2011-03-25 Info: EURONIC, FI |
Server Header | Server: Nginx Via: |
Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on kayttaytymisanalyysi.fi
Source: Web page analysis - Timestamp: 2022-09-01 17:43Latest review | 2022-09-01 17:44 |
Page language (from header) | en-US (This is often false!) |
Technologies | CloudFlare (CDN) (100% propable) Google Font API (Font Scripts) (100% propable) Google Tag Manager (Tag Managers) (100% propable) HubSpot (Marketing Automation) (100% propable) Matomo (Analytics) (100% propable) WordPress (CMSBlogs) (100% propable) Yoast SEO 19.6 (SEO) (100% propable) jQuery 3.6.0 (JavaScript Libraries) (100% propable) jQuery Migrate 3.3.2 (JavaScript Libraries) (100% propable) |
Known subdomains for kayttaytymisanalyysi.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700No subdomains found
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 24
Domain name | Final URL (when last tested) | Links | Last validity |
---|---|---|---|
abaterapia.fi | http://www.abaterapia.fi/ | 2025-06-09 | |
ahdistuksenhallinta.fi | http://www.ahdistuksenhallinta.fi/ | 2025-07-23 | |
altistus.fi | http://www.altistus.fi/ | 2025-01-05 | |
altistushoito.fi | http://www.altistushoito.fi/ | 2025-07-22 | |
altistustushoito.fi | http://www.altistustushoito.fi/ | 2025-01-05 | |
behaviorlab.fi | http://behaviorlab.fi/ | 2026-05-06 | |
dialektinenkayttaytymisterapia.fi | http://www.dialektinenkayttaytymisterapia.fi/ | 2025-04-03 | |
dkt-koulutus.fi | http://www.dkt-koulutus.fi/ | 2025-06-09 | |
dktkoulutus.fi | http://www.dktkoulutus.fi/ | 2025-06-09 | |
dkt-terapeutit.fi | http://www.dkt-terapeutit.fi/ | 2025-06-09 | |
dkt-yhdistys.fi | https://dkt-yhdistys.fi/ | 2025-10-16 | |
hot-terapia.fi | http://www.hot-terapia.fi/ | 2025-06-09 | |
hyvaksymisjaomistautumisterapia.fi | http://www.hyvaksymisjaomistautumisterapia.fi/ | 2025-07-23 | |
kayttaytymisanalyysi.fi | http://www.kayttaytymisanalyysi.fi/ | 2025-12-28 | |
kayttaytymisterapia.fi | http://www.kayttaytymisterapia.fi/ | 2026-04-05 | |
ketjuanalyysi.fi | http://www.ketjuanalyysi.fi/ | 2025-06-09 | |
kkt-koulutus.fi | http://www.kkt-koulutus.fi/ | 2025-06-09 | |
kognitiivinenterapia.fi | http://www.wisemind.fi/ | 2025-04-08 | |
psykoterapiatakuu.fi | http://www.psykoterapiatakuu.fi/ | 2025-06-09 | |
respondentti.fi | http://www.respondentti.fi/ | 2025-06-09 | |
taitoharjoittelu.fi | http://www.taitoharjoittelu.fi/ | 2025-05-30 | |
terapiakoulutus.fi | http://www.terapiakoulutus.fi/ | 2024-11-05 | |
viisaallamielella.fi | http://www.viisaallamielella.fi/ | 2025-08-15 | |
wisemind.fi | http://www.wisemind.fi/ | 2025-10-06 |