kalastusmessut.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)State | Validity expired |
Holder | Messuaukio 1, Finland |
Grant Date | 2007-03-28 |
Last Validity Date | 2024-03-28 |
Registrar | Louhi Net Oy 00520 Helsinki |
Name Servers Please see DNS section for details | dns1.louhi.net dns2.louhi.net dns3.louhi.fi |
Is The DNSSec in Use | No |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-09-01 02:11WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP source | IP address | ASN block data | IP Geolocation |
---|---|---|---|
User IP | 18.117.183.150 | This is not retrieved for now | Country: United States (US) City: Postal code: Latitude: 37.751 Longitude: -97.822 Network: 18.116.0.0/14 |
Server IP | Autonomous System (AS) #: 29422 BGP prefix: 188.117.0.0/18 Country Code: FI Registry: ripencc Allocated: 2009-06-11 Info: NBLNETWORKS-AS Nebula Oy, FI | Country: Finland (FI) State: Uusimaa (18) City: Helsinki Postal code: 00720 Latitude: 60.2448 Longitude: 24.9912 Network: 188.117.16.0/20 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud for kalastusmessut.fi
Sorry, not enough data to parse a word cloud for this site at this time
Web page details for kalastusmessut.fi
Source: Actual web page - Timestamp: 2022-10-27 18:48Header data & Meta tags | |
Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
Cascading Style Sheets (CSS) (CSS) | |
Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
JavaScript libraries |
Cookie data for kalastusmessut.fi
Source: Actual web page - Timestamp: 2022-10-27 18:48Number of cookies: 28
Cookie domain | Cookie values |
---|---|
adform.net | Cookie name: uid Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 22 bytes |
adform.net | Cookie name: C Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 2 bytes |
ads.linkedin.com | Cookie name: lang Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 18 bytes |
doubleclick.net | Cookie name: IDE Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 70 bytes |
fonts.net | Cookie name: __cf_bm Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 152 bytes |
goexpo.messukeskus.com | Cookie name: _hjIncludedInSessionSample Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 27 bytes |
goexpo.messukeskus.com | Cookie name: _hjIncludedInPageviewSample Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 28 bytes |
hubspot.com | Cookie name: __cf_bm Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 152 bytes |
linkedin.com | Cookie name: AnalyticsSyncHistory Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 106 bytes |
linkedin.com | Cookie name: UserMatchHistory Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 94 bytes |
messukeskus.com | Cookie name: _hjSessionUser_417628 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 137 bytes |
messukeskus.com | Cookie name: OptanonConsent Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 751 bytes |
messukeskus.com | Cookie name: __hssrc Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 8 bytes |
messukeskus.com | Cookie name: hubspotutk Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 42 bytes |
messukeskus.com | Cookie name: __hstc Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 92 bytes |
messukeskus.com | Cookie name: _hjAbsoluteSessionInProgress Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 29 bytes |
messukeskus.com | Cookie name: _fbp Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 33 bytes |
messukeskus.com | Cookie name: _gcl_au Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 32 bytes |
messukeskus.com | Cookie name: _hjSession_417628 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 133 bytes |
messukeskus.com | Cookie name: _hjFirstSeen Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 13 bytes |
messukeskus.com | Cookie name: _gat_gtag_UA_11620821_12 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 25 bytes |
messukeskus.com | Cookie name: _gat_UA-11620821-14 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 20 bytes |
messukeskus.com | Cookie name: _dc_gtm_UA-11620821-8 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 22 bytes |
messukeskus.com | Cookie name: _gid Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 30 bytes |
messukeskus.com | Cookie name: _ga Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 29 bytes |
messukeskus.com | Cookie name: __hssc Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 31 bytes |
youtube.com | Cookie name: VISITOR_INFO1_LIVE Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 29 bytes |
youtube.com | Cookie name: YSC Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 14 bytes |
Screenshot for kalastusmessut.fi
DNS records for kalastusmessut.fi
Source: DNS reponse - Timestamp: 2022-09-01 02:11A | kalastusmessut.fi 188.117.27.178 (Time to Live: 3600) |
MX | kalastusmessut.fi (Time to Live: 3600) |
NS | dns2.louhi.net
|
SOA | kalastusmessut.fi dns1.louhi.net (Time to Live: 3600) hostmaster.louhi.net |
Whois record history for kalastusmessut.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date | 2020-07-19 | 2021-01-19 | 2021-07-19 | 2022-07-22 | 2024-03-31 |
---|---|---|---|---|---|
Name | kalastusmessut.fi | kalastusmessut.fi | kalastusmessut.fi | kalastusmessut.fi | kalastusmessut.fi |
State | Registered | Registered | Registered | Registered | Validity expired |
Holder | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta |
Address | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2007-03-28T14:03:04 | 2007-03-28T14:03:04 | 2007-03-28T14:03:04 | 2007-03-28T14:03:04 | 2007-03-28T14:03:04 |
Registrar | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy |
PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
PostalCode | 00520 | 00520 | 00520 | 00520 | 00520 |
NameServer1 | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net |
NameServer2 | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net |
NameServer3 | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi |
PhoneNumber | +358404503250 | ||||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2022-03-28T14:03:04 | 2022-03-28T14:03:04 | 2023-03-28T14:03:04 | 2024-03-28T14:03:04 | 2024-03-28T14:03:04 |
DepartmentOrContactPerson |
Server response for kalastusmessut.fi
Source: Web server reponse - Timestamp: 2022-09-01 02:11Final URL | http://goexpo.messukeskus.com/ |
HTTP Return Code | HTTP/1.1 301 Moved Permanently |
IP Address | 188.117.27.178 Autonomous System (AS) #: 29422 BGP prefix: 188.117.0.0/18 Country Code: Finland (FI) Registry: ripencc Allocated: 2009-06-11 Info: NBLNETWORKS-AS Nebula Oy, FI |
Server Header | Server: Via: 1.1 varnish (Varnish/6.4) |
Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on kalastusmessut.fi
Source: Web page analysis - Timestamp: 2022-09-01 02:11Latest review | 2022-09-01 02:11 |
Page language (from header) | en-US (This is often false!) |
Technologies | CloudFlare (CDN) (100% propable) Google Font API (Font Scripts) (100% propable) Google Tag Manager (Tag Managers) (100% propable) HubSpot (Marketing Automation) (100% propable) Matomo (Analytics) (100% propable) WordPress (CMSBlogs) (100% propable) Yoast SEO 19.6 (SEO) (100% propable) jQuery 3.6.0 (JavaScript Libraries) (100% propable) jQuery Migrate 3.3.2 (JavaScript Libraries) (100% propable) |
Known subdomains for kalastusmessut.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700Number of subdomains found: 1
Subdomain | IP address |
---|---|
www.kalastusmessut.fi | 188.117.27.178 |
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 284
Domain name | Final URL (when last tested) | Links | Last validity |
---|---|---|---|
100ideaakevaaseen.fi | Expired 2023-01-27 | ||
55plus.fi | No DNS records found | 2025-02-09 | |
agriexpo.fi | Expired 2023-11-23 | ||
agrikone.fi | Expired 2023-11-23 | ||
agrikonemessut.fi | Expired 2023-11-23 | ||
agrimessut.fi | Expired 2023-11-23 | ||
antiikkitapahtuma.fi | http://antiikki.messukeskus.com/ | 2024-11-27 | |
apconfinland.fi | Expired 2021-08-16 | ||
arenaexpo.fi | https://arena.messukeskus.com/ | 2024-06-14 | |
asujaremontoi.fi | No DNS records found | 2024-10-25 | |
atvmessut.fi | Expired 2023-03-29 | ||
auto2017.fi | Expired 2000-12-31 | ||
auto2019.fi | http://auto.messukeskus.com/ | 2026-02-08 | |
auto2020.fi | Expired 2024-02-08 | ||
auto2021.fi | Expired 2024-02-08 | ||
auto2022.fi | Expired 2024-02-08 | ||
autokorjaamomessut.fi | https://autokorjaamo.messukeskus.com/ | 2024-09-20 | |
automaatiomessut.fi | Expired 2023-09-20 | ||
auto-messut.fi | http://auto.messukeskus.com/ | 2025-01-26 | |
båtmässa.fi | No DNS records found | 2024-09-01 | |
beautyprocover.fi | http://iloveme.messukeskus.com/beauty-pro/ | 2025-05-03 | |
beautypromessut.fi | No DNS records found | 2024-12-01 | |
bioenergyexpo.fi | Expired 2023-11-18 | ||
bioproductsexpo.fi | Expired 2023-11-18 | ||
bisnespaivat.fi | Expired 2024-01-03 | ||
bisnespäivät.fi | https://messukeskus.com/wp-signup.php?new=www.xn--bisnespivt... | 2026-01-03 | |
bolearenaclub.fi | No DNS records found | 2025-05-11 | |
bolearena.fi | No DNS records found | 2025-05-11 | |
böle.fi | No DNS records found | 2025-05-11 | |
businesstravelforum.fi | https://matka.messukeskus.com/b2b/ | 2024-05-22 | |
caravanmessut.fi | https://caravan.messukeskus.com/ | 2024-09-20 | |
chembiofinland.fi | http://chembio.messukeskus.com/ | 2025-02-19 | |
congresscenter.fi | No DNS records found | 2024-06-13 | |
congresscentre.fi | Expired 2023-09-05 | ||
conventioncenter.fi | No DNS records found | 2024-06-13 | |
conventioncentre.fi | https://messukeskus.com/wp-signup.php?new=www.conventioncent... | 2027-06-13 | |
corefair.fi | Expired 2018-04-16 | ||
coremessut.fi | Expired 2018-04-16 | ||
digiexpo.fi | Expired 2024-02-19 | ||
educafair.fi | No DNS records found | 2024-10-28 | |
educamessut.fi | No DNS records found | 2025-04-07 | |
elainystavani.fi | No DNS records found | 2025-05-20 | |
eläinystäväni.fi | No DNS records found | 2025-05-20 | |
elmamessut.fi | https://elma.messukeskus.com/ | 2024-09-05 | |
eltekmessut.fi | Expired 2023-09-04 | ||
emessukeskus.fi | http://www.emessukeskus.fi/ | 2025-03-27 | |
enviroexpo.fi | Expired 2024-01-29 | ||
facetoface.fi | Expired 2023-09-07 | ||
fairnet.fi | Expired 2023-09-04 | ||
fillarimessut.fi | https://goexpo.messukeskus.com/ | 2024-09-05 | |
finlandsmassa.fi | Expired 2023-09-04 | ||
finlandsmässa.fi | Expired 2023-09-01 | ||
finnbuild.fi | No DNS records found | 2024-09-04 | |
finnexpo.fi | Expired 2023-08-31 | ||
finnishdentalexhibition.fi | No DNS records found | 2024-11-17 | |
finnishfaircorporation.fi | https://messukeskus.com/wp-signup.php?new=www.finnishfaircor... | 2024-09-04 | |
finnsec.fi | http://www.finnsec.fi/ | 2024-09-04 | |
foodtechelsinki.fi | https://pfsptec.messukeskus.com/ | 2025-04-07 | |
formakevat.fi | Expired 2023-09-03 | ||
formakevät.fi | Expired 2023-09-03 | ||
formasyksy.fi | Expired 2023-09-03 | ||
funexpo.fi | http://www.funexpo.fi/ | 2024-09-28 | |
gamexpo.fi | Expired 2023-11-17 | ||
gastro.fi | No DNS records found | 2024-09-04 | |
gastrohelsinki.fi | No DNS records found | 2025-03-20 | |
gastropro.fi | https://gastro.messukeskus.com/ | 2024-11-01 | |
globalworkshop.fi | https://matka.messukeskus.com/ | 2024-10-25 | |
goexpo.fi | https://goexpo.messukeskus.com/ | 2025-12-04 | |
goexpohorse.fi | Expired 2023-12-06 | ||
goexpowinter.fi | Expired 2023-10-17 | ||
golfexpo.fi | Expired 2024-03-05 | ||
golfmessut.fi | https://golfmessut.fi/ | 2024-09-05 | |
graftec.fi | Expired 2024-04-22 | ||
growthhelsinki.fi | Expired 2023-02-07 | ||
gswpro.fi | Expired 2000-12-31 | ||
habitare.fi | No DNS records found | 2024-08-31 | |
habitarepro.fi | http://www.habitarepro.fi/ | 2024-09-22 | |
hammalääkäripäivätnäyttely.fi | Expired 2018-11-15 | ||
hammaslaakaripaivatnayttely.fi | No DNS records found | 2024-11-15 | |
hammaslääkäripäivätnäyttely.fi | https://hammaslaakaripaivat.messukeskus.com/ | 2024-11-25 | |
helsingforsbokmassa.fi | https://kirjamessut.messukeskus.com/?lang=sv | 2024-09-05 | |
helsingforsbokmässa.fi | https://messukeskus.com/wp-signup.php?new=www.xn--helsingfor... | 2024-09-01 | |
helsingforsmasscentrum.fi | No DNS records found | 2024-09-04 | |
helsingforsmässcentrum.fi | Expired 2019-09-01 | ||
helsingineramessut.fi | No DNS records found | 2025-04-19 | |
helsinginerämessut.fi | No DNS records found | 2025-04-19 | |
helsinginkirjamessut.fi | https://kirjamessut.messukeskus.com/ | 2024-09-05 | |
helsinginmessukeskus.fi | No DNS records found | 2024-08-31 | |
helsinginmessut.fi | http://www.wanhasatama.com/ | 2024-08-31 | |
helsinginmetsamessut.fi | Expired 2024-01-08 | ||
helsinginmetsämessut.fi | Expired 2024-01-08 | ||
helsinginmusiikkimessut.fi | Expired 2023-10-22 | ||
helsinkiboatshow.fi | No DNS records found | 2024-11-17 | |
helsinkibookfair.fi | No DNS records found | 2024-09-05 | |
helsinkicf.fi | No DNS records found | 2025-04-07 | |
helsinkiconventioncenter.fi | No DNS records found | 2025-06-13 | |
helsinkiconventioncentre.fi | No DNS records found | 2025-06-13 | |
helsinkiexhibitionandconventioncenter.fi | https://messukeskus.com/?lang=en | 2025-06-13 | |
helsinkiexhibitionandconventioncentre.fi | http://www.helsinkiexhibitionandconventioncentre.fi/ | 2025-06-13 | |
helsinkiexhibitioncenter.fi | No DNS records found | 2024-06-13 | |
helsinkiexhibitioncentre.fi | No DNS records found | 2025-06-13 | |
helsinkifaircentre.fi | http://messukeskus.com/?lang=en | 2024-09-04 | |
helsinkihorsefair.fi | http://www.helsinkihorsefair.fi/ | 2024-09-20 | |
highendhelsinki.fi | Expired 2024-01-18 | ||
highendhifi.fi | Expired 2024-01-16 | ||
himss.fi | No DNS records found | 2024-11-16 | |
horsefair.fi | Expired 2024-04-23 | ||
hpmessut.fi | http://www.hpmessut.fi/ | 2024-06-07 | |
hupicon.fi | No DNS records found | 2024-10-06 | |
iloveme.fi | http://iloveme.messukeskus.com/ | 2025-01-18 | |
infraexpo.fi | Expired 2024-01-31 | ||
jatevesiymparisto.fi | No DNS records found | 2024-09-04 | |
jätevesiympäristö.fi | http://www.xn--jtevesiymprist-5hbj42a.fi/ | 2024-09-04 | |
jewelandwatch.fi | Expired 2023-11-27 | ||
jobforum.fi | Expired 2023-10-22 | ||
jointec.fi | Expired 2024-04-24 | ||
jonnela.fi | No DNS records found | 2024-10-30 | |
jonnelaklubi.fi | No DNS records found | 2024-10-30 | |
julkinenateria.fi | https://ateria.messukeskus.com/ | 2024-11-25 | |
julkisivumessut.fi | Expired 2019-01-18 | ||
kadentaitotapahtuma.fi | Expired 2024-02-26 | ||
kädentaitotapahtuma.fi | Expired 2024-02-26 | ||
kalastusmessut.fi | Expired 2024-03-28 | ||
kauneusmessut.fi | No DNS records found | 2024-09-04 | |
kevaanmerkit.fi | Expired 2024-03-30 | ||
keväänmerkit.fi | Expired 2024-03-30 | ||
kevatmessut.fi | http://www.kevatmessut.fi/ | 2025-01-08 | |
kevätmessut.fi | http://www.xn--kevtmessut-s5a.fi/ | 2025-01-08 | |
kevatpuutarha.fi | http://kevatmessut.messukeskus.com/ | 2024-09-04 | |
kiinteistoklusteri.fi | Expired 2024-03-29 | ||
kiinteistöklusteri.fi | Expired 2024-03-29 | ||
kiinteistomessut.fi | http://www.kiinteistomessut.fi/ | 2024-09-20 | |
kiinteistömessut.fi | No DNS records found | 2024-09-01 | |
kiinteistoplusturvallisuus.fi | Expired 2024-03-05 | ||
kiinteistöplusturvallisuus.fi | Expired 2024-03-05 | ||
kokoustamo.fi | Expired 2023-09-25 | ||
korjausjarakentaminen.fi | Expired 2023-09-07 | ||
korjausrakentaminen2018.fi | Expired 2023-10-04 | ||
korujakello.fi | Expired 2023-11-27 | ||
korujakellomessut.fi | Expired 2023-11-27 | ||
kuljetuslogistiikka.fi | Expired 2023-09-05 | ||
kutsutapahtumaan.fi | No DNS records found | 2024-10-25 | |
laakaripaivatnayttely.fi | https://laakaripaivat.messukeskus.com/ | 2024-09-20 | |
lääkäripäivätnäyttely.fi | No DNS records found | 2025-09-01 | |
lahiruokaluomu.fi | https://lahiruokajaluomu.messukeskus.com/ | 2024-09-21 | |
lähiruokaluomu.fi | https://kevatmessut.messukeskus.com/ | 2024-09-21 | |
lapsimessut.fi | https://lapsimessut.messukeskus.com/ | 2024-09-05 | |
lautasella.fi | No DNS records found | 2025-06-08 | |
lemmikkitapahtuma.fi | No DNS records found | 2024-12-16 | |
liikelahjamessut.fi | Expired 2019-10-30 | ||
liikelahjatmessut.fi | Expired 2019-10-30 | ||
logistiikkakuljetus.fi | Expired 2023-09-05 | ||
maatalouskonemessut.fi | https://maatalouskone.messukeskus.com/ | 2024-11-23 | |
maintec.fi | Expired 2018-04-22 | ||
manufacturingmaterials.fi | Expired 2023-10-30 | ||
markkinoinninviikko.fi | Expired 2024-03-09 | ||
matkahuutokauppa.fi | Expired 2019-12-13 | ||
matkailupalkinto.fi | Expired 2018-11-30 | ||
matkamessut.fi | No DNS records found | 2024-09-05 | |
matkapro.fi | No DNS records found | 2024-11-20 | |
maxpo.fi | http://www.maxpo.fi/ | 2024-09-04 | |
mecatec.fi | Expired 2023-08-31 | ||
meetfinland.fi | No DNS records found | 2024-09-28 | |
meidanviikonloppu.fi | Expired 2024-02-18 | ||
meidänviikonloppu.fi | Expired 2024-02-18 | ||
mesoaja.fi | http://www.mesoaja.fi/ | 2024-07-31 | |
messuhelmi.fi | Expired 2018-05-29 | ||
messukeskus100.fi | Expired 2023-11-20 | ||
messukeskushelsinki.fi | No DNS records found | 2024-10-10 | |
messukirppis.fi | Expired 2019-02-06 | ||
messuklubi.fi | No DNS records found | 2024-09-18 | |
messukutsu.fi | No DNS records found | 2024-05-22 | |
messumedia.fi | http://www.messumedia.fi/ | 2024-09-04 | |
messuparkki.fi | No DNS records found | 2025-05-29 | |
messut100.fi | No DNS records found | 2025-12-13 | |
messutapahtumat.fi | No DNS records found | 2024-09-20 | |
messuvalmennus.fi | No DNS records found | 2025-01-14 | |
metsamessut.fi | https://metsa.messukeskus.com/ | 2025-05-16 | |
metsämessut.fi | No DNS records found | 2024-05-16 | |
metsastysmessut.fi | Expired 2024-04-22 | ||
metsästysmessut.fi | Expired 2019-04-22 | ||
model-expo.fi | Expired 2023-10-14 | ||
modelexpo.fi | Expired 2023-10-14 | ||
moottorikelkkamessut.fi | Expired 2024-03-29 | ||
moottoripyoranayttely.fi | Expired 2024-02-19 | ||
moottoripyöränäyttely.fi | No DNS records found | 2024-09-01 | |
motokuume.fi | http://www.motokuume.fi/ | 2024-12-04 | |
motokuumemittari.fi | Expired 2024-01-21 | ||
mp-messut.fi | No DNS records found | 2024-09-29 | |
mpmessut.fi | http://mp.messukeskus.com/ | 2025-02-21 | |
mp-nayttely.fi | http://www.mp-nayttely.fi/ | 2025-02-19 | |
mprock.fi | Expired 2023-06-21 | ||
mpstars.fi | Expired 2023-11-02 | ||
muotimessut.fi | No DNS records found | 2024-09-04 | |
nayttely.fi | Expired 2023-09-05 | ||
nbe.fi | Expired 2023-09-11 | ||
nordictravelfair.fi | http://matka.messukeskus.com/?lang=en | 2024-10-06 | |
oispatalvi.fi | http://www.oispatalvi.fi/ | 2024-09-14 | |
omakotimessut.fi | http://kevatmessut.messukeskus.com/ | 2024-09-20 | |
omamokki.fi | No DNS records found | 2024-09-04 | |
omamökki.fi | No DNS records found | 2024-09-01 | |
omapiha.fi | No DNS records found | 2024-09-04 | |
onseala.fi | No DNS records found | 2025-03-21 | |
outdoorexpo.fi | http://www.outdoorexpo.fi/ | 2024-12-16 | |
pactec.fi | No DNS records found | 2024-08-31 | |
petrolcircus.fi | No DNS records found | 2024-11-17 | |
plastexpo.fi | Expired 2023-09-24 | ||
pomppulinnataivas.fi | Expired 2023-10-25 | ||
pranabeats.fi | Expired 2019-10-13 | ||
pratkakuume.fi | Expired 2018-06-08 | ||
promoexpo.fi | Expired 2023-11-21 | ||
pulpandbeyond.fi | No DNS records found | 2025-05-11 | |
pulpaper.fi | No DNS records found | 2024-09-04 | |
pwaexpo.fi | Expired 2021-04-27 | ||
pwa.fi | Expired 2024-04-27 | ||
reset16.fi | Expired 2020-01-29 | ||
reset17.fi | Expired 2019-08-18 | ||
reset2017.fi | Expired 2019-08-17 | ||
retkimessut.fi | Expired 2024-02-19 | ||
robtec.fi | Expired 2000-12-31 | ||
ruokamessuthelsinki.fi | No DNS records found | 2025-01-09 | |
sahko-electricity.fi | No DNS records found | 2025-03-25 | |
sähkö-electricity.fi | No DNS records found | 2025-03-25 | |
sahkoexpo.fi | http://www.sahkoexpo.fi/ | 2025-03-25 | |
sähköexpo.fi | No DNS records found | 2025-03-25 | |
sähkömessut.fi | No DNS records found | 2025-02-15 | |
sairaanhoitajapaivatnayttely.fi | No DNS records found | 2025-04-20 | |
sairaanhoitajapäivätnäyttely.fi | No DNS records found | 2025-04-20 | |
seatechelsinki.fi | Expired 2000-12-31 | ||
secd-day.fi | No DNS records found | 2025-02-19 | |
seonala.fi | No DNS records found | 2025-04-19 | |
showroomfair.fi | Expired 2023-11-23 | ||
signtec.fi | Expired 2024-01-29 | ||
sihteeriassistenttimessut.fi | Expired 2023-10-30 | ||
sihteeriassistenttipaivat.fi | Expired 2023-10-30 | ||
sihteeriassistenttipäivät.fi | Expired 2023-10-30 | ||
sijoittaja23.fi | No DNS records found | 2025-05-15 | |
sijoittaja25.fi | No DNS records found | 2025-05-15 | |
sijoittaja26.fi | No DNS records found | 2025-05-15 | |
sijoittaja27.fi | No DNS records found | 2025-05-15 | |
sijoittajamessut.fi | https://sijoittajamessut.messukeskus.com/ | 2025-01-08 | |
sisahuvipuisto.fi | No DNS records found | 2024-06-13 | |
sisustamessut.fi | https://kevatmessut.messukeskus.com/ | 2024-06-14 | |
sisustusmessut.fi | Expired 2024-03-28 | ||
sporttitaivas.fi | https://messukeskus.com/wp-signup.php?new=www.sporttitaivas.... | 2024-06-15 | |
studiamessut.fi | http://studia.messukeskus.com/ | 2024-10-29 | |
suomenmessut.fi | http://messukeskus.com/ | 2024-08-31 | |
suomenmetsamessut.fi | No DNS records found | 2025-07-03 | |
suomenmetsämessut.fi | No DNS records found | 2024-07-03 | |
suomenvideoviestinta.fi | http://www.suomenvideoviestinta.fi/ | 2024-08-24 | |
svv.fi | https://svv.fi/ | 2024-09-04 | |
tanssiviekoon.fi | Expired 2023-12-22 | ||
teknologia17.fi | Expired 2019-03-19 | ||
teknologia19.fi | Expired 2024-03-19 | ||
teknologia21.fi | https://teknologia.messukeskus.com/ | 2024-10-16 | |
teknologia22.fi | No DNS records found | 2024-09-28 | |
teknologia23.fi | No DNS records found | 2025-02-20 | |
teknologiatapahtuma.fi | No DNS records found | 2024-08-16 | |
tempaudu.fi | No DNS records found | 2024-08-14 | |
terveysmessut.fi | No DNS records found | 2024-09-04 | |
terveytesimessut.fi | No DNS records found | 2024-06-08 | |
tooltec.fi | https://teknologia.messukeskus.com/ | 2026-05-08 | |
travelfair.fi | http://www.travelfair.fi/ | 2024-10-06 | |
tsigaboom.fi | https://tsigaboom.messukeskus.com/ | 2024-08-15 | |
turvallisuus2021.fi | Expired 2023-04-09 | ||
turvallisuusmessut2021.fi | Expired 2023-04-09 | ||
turvallisuustapahtuma.fi | No DNS records found | 2024-09-27 | |
valomessut.fi | http://www.valomessut.fi/ | 2027-03-30 | |
valotapahtuma.fi | Expired 2024-03-30 | ||
varipinta.fi | Expired 2023-09-05 | ||
väripinta.fi | Expired 2023-09-01 | ||
venemessut.fi | http://vene.messukeskus.com/ | 2024-09-04 | |
vihertek.fi | Expired 2023-11-04 | ||
viiniexpo.fi | Expired 2023-09-04 | ||
viiniruoka.fi | http://www.viiniruoka.fi/ | 2025-04-28 | |
visitmatka.fi | No DNS records found | 2024-08-31 | |
winterexpo.fi | Expired 2023-10-17 | ||
woodexpo.fi | Expired 2023-11-18 | ||
ymparistomessut.fi | Expired 2023-09-05 | ||
ympäristömessut.fi | Expired 2023-09-01 | ||
ymparistotekniikkamessut.fi | http://www.ymparistotekniikkamessut.fi/ | 2024-06-06 | |
ympäristötekniikkamessut.fi | https://messukeskus.com/wp-signup.php?new=www.xn--ympristtek... | 2024-06-06 | |
yritys2017.fi | Expired 2021-02-03 | ||
yritys2018.fi | No DNS records found | 2027-01-26 |