discgolfstore.fi
Detaljer
Källa: Finlands transport- och kommunikationsbyrå (Traficom) och Internet Assigned Numbers Authority (IANA)Status | Registered |
Hållare | Kievarinkatu 5, Finland |
Beviljningsdatum | 2012-02-08 |
Sista giltighetsdatum | 2025-02-08 |
Registrator | www design 38840 Niinisalo |
Namnservrar Se DNS-avsnittet för detaljer | ns1.nettipertti.fi ns2.nettipertti.fi |
Är DNSSec i bruk | No |
IANA detaljer för suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP
Källa: Faktisk webbsida - Tidsstämpel: 2022-10-11 04:14VARNING: Observera att platsen kan vara helt fel om servern använder t.ex. omvänd proxy som Cloudflare
IP source | IP address | ASN block data | IP Geolocation |
---|---|---|---|
Användar-IP | 3.144.202.167 | Detta hämtas inte för tillfället | Country: United States (US) City: Postal code: Latitude: 37,751 Longitude: -97,822 Network: 3.144.0.0/12 |
Server-IP | Autonomous System (AS) #: 24940 BGP prefix: 95.217.0.0/16 Country Code: DE Registry: ripencc Allocated: 2009-02-24 Info: HETZNER-AS, DE | Country: Germany (DE) City: Postal code: Latitude: 51,2993 Longitude: 9,491 Network: 95.217.128.0/17 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud för discgolfstore.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-10-11 04:14Lägga märke till: Diverse ord tas bort från molnet för att förbättra analysen
Webbsida information för discgolfstore.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-12-03 09:29Header data & Metataggar | title Frisbeegolf-forum.fi - Index viewport width=device-width, initial-scale=1 not_found text/html; charset=UTF-8 description Frisbeegolf-forum.fi - Index |
Öppna graf (OG) metataggar | Att använda Open Graph-taggar rekommenderas starkt för sökmotoroptimering (SEO) |
Twitter-kort | Att använda Twitter-taggar rekommenderas starkt för sökmotoroptimering (SEO) |
Cascading Style Sheets (CSS) (CSS) | https://www.frisbeegolf-forum.fi/themes/default/css/webkit.css https://www.frisbeegolf-forum.fi/themes/vvide/css/webtiryaki.css?fin20 https://www.frisbeegolf-forum.fi/themes/vvide/css/bootstrap.css https://www.frisbeegolf-forum.fi/themes/vvide/css/index.css?fin20 https://www.frisbeegolf-forum.fi/themes/vvide/css/font-awesome.min.css?fin20 |
Länkar till sociala medier (SOME) | Att ha innehåll i sociala medier rekommenderas starkt för sökmotoroptimering (SEO) |
JavaScript-bibliotek | https://www.frisbeegolf-forum.fi/themes/vvide/scripts/jquery.min.js?fin20 //pagead2.googlesyndication.com/pagead/js/adsbygoogle.js https://www.frisbeegolf-forum.fi/themes/default/scripts/sha1.js https://www.frisbeegolf-forum.fi/themes/default/scripts/script.js?fin20 https://www.frisbeegolf-forum.fi/themes/vvide/scripts/app.js?fin20 https://www.frisbeegolf-forum.fi/themes/vvide/scripts/bootstrap.min.js?fin20 https://pagead2.googlesyndication.com/pagead/js/adsbygoogle.js https://www.frisbeegolf-forum.fi/themes/vvide/scripts/theme.js?fin20 |
Cookie-data för discgolfstore.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-12-03 09:29Antal kakor: 25
Cookie-domän | Cookievärden |
---|---|
adnxs.com | Cookie name: uuid2 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 24 bitgrupper |
adnxs.com | Cookie name: anj Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 113 bitgrupper |
agkn.com | Cookie name: u Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 42 bitgrupper |
agkn.com | Cookie name: ab Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 43 bitgrupper |
casalemedia.com | Cookie name: CMPS Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 8 bitgrupper |
casalemedia.com | Cookie name: CMID Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 28 bitgrupper |
casalemedia.com | Cookie name: CMTS Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 8 bitgrupper |
casalemedia.com | Cookie name: CMPRO Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 9 bitgrupper |
doubleclick.net | Cookie name: IDE Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 70 bitgrupper |
doubleclick.net | Cookie name: DSID Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 11 bitgrupper |
frisbeegolf-forum.fi | Cookie name: __gads Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 106 bitgrupper |
frisbeegolf-forum.fi | Cookie name: __utmb Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 30 bitgrupper |
frisbeegolf-forum.fi | Cookie name: __utma Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 59 bitgrupper |
frisbeegolf-forum.fi | Cookie name: __utmt Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 7 bitgrupper |
frisbeegolf-forum.fi | Cookie name: __utmz Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 75 bitgrupper |
frisbeegolf-forum.fi | Cookie name: __utmc Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 14 bitgrupper |
innovid.com | Cookie name: uuid Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 58 bitgrupper |
pubmatic.com | Cookie name: KTPCACOOKIE Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 14 bitgrupper |
pubmatic.com | Cookie name: KADUSERCOOKIE Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 49 bitgrupper |
quantserve.com | Cookie name: mc Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 28 bitgrupper |
quantserve.com | Cookie name: cref Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 5 bitgrupper |
quantserve.com | Cookie name: d Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 13 bitgrupper |
rlcdn.com | Cookie name: pxrc Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 32 bitgrupper |
rlcdn.com | Cookie name: rlas3 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 49 bitgrupper |
www.frisbeegolf-forum.fi | Cookie name: PHPSESSID Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 35 bitgrupper |
Skärmdump för discgolfstore.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-10-11 04:14
DNS-poster för discgolfstore.fi
Källa: DNS-svar - Tidsstämpel: 2022-10-11 04:14A | discgolfstore.fi 95.217.149.110 (Time to Live: 3600) |
MX | posti.nettipertti.fi (Time to Live: 3600) |
NS | ns2.nettipertti.fi
|
SOA | discgolfstore.fi ns1.nettipertti.fi (Time to Live: 21600) hostmaster.nettipertti.fi |
TXT | SPF records: v=spf1 mx ~all |
Whois rekordhistoria för discgolfstore.fi
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Visar senaste max 5 upptäckte förändringar i posterna. Ändringar markeras
Datum | 2022-02-25 | 2023-02-10 | 2023-03-04 | 2024-02-10 | 2024-03-07 |
---|---|---|---|---|---|
Name | discgolfstore.fi | discgolfstore.fi | discgolfstore.fi | discgolfstore.fi | discgolfstore.fi |
State | Registered | Validity expired | Registered | Validity expired | Registered |
Holder | www design | www design | www design | www design | www design |
Address | Kievarinkatu 5 | Kievarinkatu 5 | Kievarinkatu 5 | Kievarinkatu 5 | Kievarinkatu 5 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2012-02-08T14:26:56 | 2012-02-08T14:26:56 | 2012-02-08T14:26:56 | 2012-02-08T14:26:56 | 2012-02-08T14:26:56 |
Registrar | www design | www design | www design | www design | www design |
PostalArea | Niinisalo | Niinisalo | Niinisalo | Niinisalo | Niinisalo |
PostalCode | 38840 | 38840 | 38840 | 38840 | 38840 |
NameServer1 | ns1.nettipertti.fi | ns1.nettipertti.fi | ns1.nettipertti.fi | ns1.nettipertti.fi | ns1.nettipertti.fi |
NameServer2 | ns2.nettipertti.fi | ns2.nettipertti.fi | ns2.nettipertti.fi | ns2.nettipertti.fi | ns2.nettipertti.fi |
PhoneNumber | |||||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 2503281-8 | 2503281-8 | 2503281-8 | 2503281-8 | 2503281-8 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2023-02-08T12:37:41 | 2023-02-08T12:37:41 | 2024-02-08T12:37:41 | 2024-02-08T12:37:41 | 2025-02-08T12:37:41 |
DepartmentOrContactPerson |
Server svar för discgolfstore.fi
Källa: Webbserversvar - Tidsstämpel: 2022-10-11 04:14Slutlig URL | https://www.frisbeegolf-forum.fi/ |
HTTP-returkod | HTTP/1.1 200 OK |
IP-adress | 95.217.149.110 Autonomous System (AS) #: 24940 BGP prefix: 95.217.0.0/16 Country Code: Germany (DE) Registry: ripencc Allocated: 2009-02-24 Info: HETZNER-AS, DE |
Serverhuvud | Server: Apache Via: |
Certifikat | Issued By: Let's Encrypt Issuer details: O=Let's Encrypt, United States (US) Issuer details: CN=R3 Version: 2 Algorithm: RSA-SHA256 Issued On: 2022-08-23 00:00:00 Expires On: 2022-11-21 00:00:00 |
Certifikatämne | Country (C): Location (L): Organization (O): Common Name (CN): frisbeegolf-forum.fi |
Certifikat alternativa namn | discgolfstore.fi frisbeegolf-forum.fi www.discgolfstore.fi www.frisbeegolf-forum.fi |
Begagnade tekniker på discgolfstore.fi
Källa: Webbsideanalys - Tidsstämpel: 2022-10-11 04:14Senaste recensionen | 2022-10-11 04:14 |
Sidspråk (från rubrik) | en (Detta är ofta falskt!) |
Technologies | Elementor 3.7.8 (Landing Page Builders) (100% propable) Google Font API (Font Scripts) (100% propable) Nginx (Web ServersReverse Proxy) (100% propable) Swiper Slider (Miscellaneous) (100% propable) Twitter Emoji (Twemoji) (Miscellaneous) (100% propable) Underscore.js 1.13.3 (JavaScript Libraries) (100% propable) WordPress 6.0.2 (CMSBlogs) (100% propable) jQuery 1.13.1 (JavaScript Libraries) (100% propable) jQuery Migrate 3.3.2 (JavaScript Libraries) (100% propable) |
Kända underdomäner för discgolfstore.fi
Källa: Sökmotorer och DNS-poster (MEDDELANDE: De flesta kanske inte kan nås (internt / DMZ / föråldrat)). Visar max rader 700Inga underdomäner hittades
Webbhotellleverantörer
Källa: Alla giltiga företagswebbplatser med innehåll (se tabellen nedan)
Domäner som ägs av samma ägare (nuvarande och tidigare)
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Antal domäner: 161
Domän namn | Slutlig URL (när sist testades) | Länkar | Sista giltighet |
---|---|---|---|
4321.fi | Utgånget 2022-01-11 | ||
ad-kpaa.fi | Inga DNS-poster hittades | 2025-04-20 | |
africar.fi | Inga DNS-poster hittades | 2025-02-12 | |
ahofarm.fi | Utgånget 2000-12-31 | ||
airportpark.fi | http://www.airportpark.fi/ | 2025-01-16 | |
ammattikalastusmessut.fi | Inga DNS-poster hittades | 2025-03-14 | |
auto-sabo.fi | http://www.auto-sabo.fi/ | 2024-08-06 | |
autosabo.fi | http://www.autosabo.fi/ | 2024-08-06 | |
avainauto.fi | Utgånget 2022-07-31 | ||
benzboy.fi | Utgånget 2018-08-14 | ||
design-suomi.fi | Utgånget 2019-10-23 | ||
discgolfstore.fi | https://www.frisbeegolf-forum.fi/ | 2025-02-08 | |
driveit.fi | Utgånget 2020-01-22 | ||
elinvoimainenkankaanpaa.fi | Utgånget 2023-09-06 | ||
eurogarment.fi | Utgånget 2020-07-05 | ||
fixus-kankaanpaa.fi | Utgånget 2023-03-31 | ||
frisbeegolf-forum.fi | http://www.frisbeegolf-forum.fi/ | 2025-01-01 | |
frisbeegolfkauppa.fi | http://www.frisbeegolfkauppa.fi/ | 2025-02-08 | |
futsalforum.fi | http://www.futsalforum.fi/ | 2024-12-13 | |
geopark-suomi.fi | Utgånget 2023-04-30 | ||
grillivaunut.fi | http://www.grillivaunut.fi/ | 2025-01-18 | |
hatax.fi | Inga DNS-poster hittades | 2024-12-03 | |
hennakyrojoki.fi | Inga DNS-poster hittades | 2025-01-26 | |
hevosenhetki.fi | Utgånget 2021-05-25 | ||
hotellitoholampi.fi | Utgånget 2019-08-14 | ||
ideaparkopen.fi | Inga DNS-poster hittades | 2025-04-08 | |
ilmalampopumppukauppa.fi | http://www.ilmalampopumppukauppa.fi/ | 2024-06-14 | |
ilmavideot.fi | http://www.ilmavideot.fi/ | 2024-08-26 | |
itpaja.fi | Utgånget 2020-03-23 | ||
itpalvelukallionkieli.fi | Utgånget 2020-05-02 | ||
jaanantaksi.fi | Inga DNS-poster hittades | 2024-12-13 | |
jk-inks.fi | Utgånget 2018-12-10 | ||
jvsahkoasennus.fi | http://www.jvsahkoasennus.fi/ | 2024-08-04 | |
jvsähköasennus.fi | http://www.xn--jvshkasennus-icb8w.fi/ | 2024-08-04 | |
kalastustukku.fi | Utgånget 2024-01-22 | ||
kama1958.fi | http://www.kama1958.fi/ | 2024-06-14 | |
kangasfysio.fi | Utgånget 2020-02-04 | ||
kankaanpaanautohuolto.fi | Inga DNS-poster hittades | 2025-03-10 | |
kankaanpaanjoulu.fi | Utgånget 2019-11-02 | ||
kankaanpäänjoulu.fi | Utgånget 2019-11-02 | ||
kankaanpaanlasi.fi | https://xn--kankaanpnlasi-ifba.fi/ | 2024-12-13 | |
kankaanpäänlasi.fi | https://xn--kankaanpnlasi-ifba.fi/ | 2024-08-26 | |
kankaanpaanmetsastysyhdistys.fi | Inga DNS-poster hittades | 2024-11-22 | |
kankaanpäänmetsastysyhdistys.fi | http://kankaanpaanmetsastysyhdistys.fi/ | 2024-11-22 | |
kankaanpäänmetsästysyhdistys.fi | http://kankaanpaanmetsastysyhdistys.fi/ | 2025-02-26 | |
kankaanpaanomaishoitajat.fi | http://www.kankaanpaanomaishoitajat.fi/ | 2025-02-01 | |
katalysaattorit.fi | http://www.katalysaattorit.fi/ | 2025-02-19 | |
katsastusasemat.fi | Utgånget 2024-03-26 | ||
kaupunkiseikkailu.fi | Inga DNS-poster hittades | 2024-05-10 | |
keilailuliitto.fi | http://www.keilailuliitto.fi/ | 2025-01-15 | |
kerola.fi | http://www.kerola.fi/ | 2025-01-16 | |
keskofood.fi | http://www.keskofood.fi/ | 2025-01-15 | |
kesyry.fi | https://kesyry.fi/ | 2025-03-22 | |
kiikanwallin.fi | Inga DNS-poster hittades | 2024-07-30 | |
konsulentit.fi | Inga DNS-poster hittades | 2024-08-27 | |
konsulentti.fi | http://dan.com/buy-domain/konsulentti.fi?redirected=true | 2024-08-27 | |
koota.fi | Inga DNS-poster hittades | 2025-01-15 | |
kotiyleiso.fi | Utgånget 2019-06-21 | ||
kpaalasi.fi | http://www.kpaalasi.fi/ | 2025-02-17 | |
kuninkaanlahde.fi | https://www.design.yt/ | 2025-03-19 | |
kuninkaanlähde.fi | http://www.xn--kuninkaanlhde-kfb.fi/ | 2025-03-03 | |
kuntoutuskumppani.fi | Inga DNS-poster hittades | 2024-09-29 | |
kuntoutuspaikkasi.fi | Inga DNS-poster hittades | 2025-01-13 | |
kyrojoki.fi | Inga DNS-poster hittades | 2025-01-27 | |
laboratoriotarvike.fi | Utgånget 2023-02-03 | ||
lammoneriste.fi | Utgånget 2023-02-02 | ||
lämmöneriste.fi | Utgånget 2023-02-02 | ||
lämpöpumppukauppa.fi | https://wattila.fi/ | 2025-01-30 | |
lampopumppukeskus.fi | Utgånget 2024-02-25 | ||
lampopumppuvaraosat.fi | Inga DNS-poster hittades | 2025-01-16 | |
lauantaitorit.fi | https://design.yt/ | 2025-04-05 | |
lekatec.fi | Utgånget 2021-07-30 | ||
lelesb.fi | http://www.lelesb.fi/ | 2024-08-11 | |
lemppu.fi | http://www.lemppu.fi/ | 2024-05-25 | |
lemppulegends.fi | Inga DNS-poster hittades | 2024-08-25 | |
leppisfishing.fi | Utgånget 2022-03-26 | ||
levinhenkireika.fi | https://levinhenkireika.fi/ | 2025-05-02 | |
löytökorpi.fi | Inga DNS-poster hittades | 2025-03-17 | |
maila.fi | http://www.maila.fi/ | 2025-02-22 | |
meggala.fi | Utgånget 2021-12-27 | ||
metsastyskeskustelu.fi | Utgånget 2024-01-22 | ||
mkenergiakuljetus.fi | Inga DNS-poster hittades | 2024-08-14 | |
mm-kaupat.fi | https://www.nettiauto.com/yritys/343149 | 2024-06-06 | |
monioljypoltin.fi | https://xn--moniljypolttimet-pwb.fi/ | 2024-05-21 | |
monioljypolttimenvaraosat.fi | http://www.monioljypolttimenvaraosat.fi/ | 2024-11-16 | |
monioljypolttimet.fi | https://www.monioljypolttimet.fi/ | 2024-08-26 | |
mpvarikko.fi | Utgånget 2021-05-03 | ||
murskamies.fi | http://www.murskamies.fi/ | 2024-12-30 | |
myyntivaunut.fi | https://www.myyntivaunut.fi/ | 2024-05-30 | |
neoen.fi | http://www.neoen.fi/ | 2024-09-29 | |
neoen-finland.fi | http://www.neoen-finland.fi/ | 2024-09-29 | |
nesvuokrapelit.fi | Utgånget 2000-12-31 | ||
nettipalvelin.fi | http://www.nettipalvelin.fi/ | 2025-01-11 | |
nettipertti.fi | http://design.yt/ | 2024-12-02 | |
nibevaraosat.fi | Inga DNS-poster hittades | 2025-01-16 | |
nonstopparturi.fi | http://www.nonstopparturi.fi/ | 2024-12-03 | |
northecoclean.fi | Utgånget 2021-09-29 | ||
nuhvi.fi | https://www.nuhvi.fi/index.php/fi/ | 2025-02-25 | |
ohjelmasiili.fi | Utgånget 2019-08-24 | ||
öljysäiliö.fi | Utgånget 2022-03-25 | ||
olkimix.fi | Utgånget 2019-06-26 | ||
oulunautohuolto.fi | http://www.oulunautohuolto.fi/ | 2025-01-22 | |
oxdog.fi | http://www.oxdog.fi/ | 2024-11-20 | |
pauliinap.fi | Utgånget 2000-12-31 | ||
pe-53.fi | Utgånget 2019-01-01 | ||
pelaajaboardcast.fi | https://pelaajaboardcast.fi/ | 2024-10-07 | |
pesapalloforum.fi | http://www.pesapalloforum.fi/ | 2025-01-18 | |
pesisforum.fi | Inga DNS-poster hittades | 2026-01-18 | |
pesisportaali.fi | http://www.pesisportaali.fi/ | 2025-01-05 | |
pienisuuriidea.fi | https://pienisuuriidea.fi/ | 2024-10-15 | |
pirkanmaanpohjarakennus.fi | https://pirkanmaanpohjarakennus.fi/ | 2024-09-23 | |
pomarkunpyry.fi | https://design.yt/ | 2025-03-09 | |
pompy.fi | https://design.yt/ | 2025-03-09 | |
porintilausajo.fi | http://www.porintilausajo.fi/ | 2025-01-15 | |
ps82.fi | Utgånget 2018-03-07 | ||
putkiasennusta.fi | Utgånget 2023-01-22 | ||
rajalamotorsport.fi | https://www.rajalamotorsport.fi/ | 2024-04-30 | |
rakennuskiviranta.fi | Utgånget 2020-03-02 | ||
rakennuspalvelujarvinen.fi | Inga DNS-poster hittades | 2025-04-21 | |
reseptikilpailu.fi | Utgånget 2021-12-06 | ||
retkilemi.fi | Inga DNS-poster hittades | 2024-08-03 | |
roskala.fi | Utgånget 2000-12-31 | ||
rudanco.fi | https://rudanco.fi/ | 2024-08-09 | |
sahkomopo.fi | Inga DNS-poster hittades | 2025-01-15 | |
sähkösun.fi | http://www.xn--shksun-bua0m.fi/ | 2024-07-27 | |
salibandyforum.fi | http://www.salibandyforum.fi/ | 2025-01-04 | |
salonsaxin.fi | http://www.salonsaxin.fi/ | 2024-05-15 | |
sarmeen.fi | http://www.sarmeen.fi/ | 2024-05-25 | |
satakunnantaksi.fi | Utgånget 2024-03-24 | ||
satakunnantieisannointi.fi | https://satakunnantieisannointi.fi/ | 2025-03-05 | |
satakunnanurheiluklinikka.fi | Utgånget 2021-09-13 | ||
sillanmaki.fi | https://www.sillanmaki.fi/ | 2024-12-11 | |
sinituuli.fi | http://www.sinituuli.fi/ | 2025-01-16 | |
snowracers.fi | Utgånget 2023-09-12 | ||
solarsuomi.fi | https://www.solar.eu/ | 2025-01-15 | |
suomenravintolalaite.fi | https://suomenravintolalaite.fi/ | 2024-09-06 | |
tacogarcia.fi | Utgånget 2022-01-05 | ||
taksileponiemi.fi | http://www.taksileponiemi.fi/ | 2024-12-14 | |
tapahtumaviikko.fi | Utgånget 2023-01-22 | ||
teollisuusimuri.fi | Utgånget 2023-03-11 | ||
tiinajalasse.fi | Utgånget 2019-02-26 | ||
tilataksipori.fi | https://tilataksipori.fi/ | 2025-02-12 | |
tomoottajat.fi | http://www.tomoottajat.fi/ | 2025-03-19 | |
traktoripalvelu.fi | http://www.traktoripalvelu.fi/ | 2025-01-16 | |
trukkikortti.fi | Utgånget 2022-03-26 | ||
turunsinappi.fi | https://www.turunsinappia.fi/ | 2025-01-15 | |
unf.fi | http://www.unf.fi/ | 2025-01-15 | |
valokuvaajapauliinap.fi | Utgånget 2000-12-31 | ||
varastoon.fi | https://www.tilacenter.fi/ | 2024-08-19 | |
varisuora.fi | http://www.varisuora.fi/ | 2025-01-16 | |
verkkokauppakorpela.fi | http://www.verkkokauppakorpela.fi/ | 2024-11-16 | |
vervevara.fi | Utgånget 2023-06-20 | ||
vientiautot.fi | https://www.vientiautot.fi/ | 2025-05-10 | |
vihapulla.fi | Inga DNS-poster hittades | 2025-01-26 | |
vikailmoitukset.fi | http://www.vikailmoitukset.fi/ | 2025-01-16 | |
vikapihalle.fi | Utgånget 2021-10-11 | ||
volvo-ohjelmointi.fi | Utgånget 2022-10-21 | ||
volvoohjelmointi.fi | Utgånget 2022-10-21 | ||
wwwdesign.fi | http://www.wwwdesign.fi/ | 2025-01-11 | |
yli-rami.fi | http://www.yli-rami.fi/ | 2025-02-08 | |
yritysesittelyvideo.fi | http://www.yritysesittelyvideo.fi/ | 2025-01-22 |