teidentukko.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)| State | Registered |
| Holder | Puurtajankuja 3D 50, Finland |
| Grant Date | 2021-06-23 |
| Last Validity Date | 2024-06-23 |
| Registrar | Euronic Oy 04440 Järvenpää |
| Name Servers Please see DNS section for details | ns1.euronic.fi ns2.euronic.fi ns3.euronic.fi |
| Is The DNSSec in Use | No |
| IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-09-19 10:13WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
| IP source | IP address | ASN block data | IP Geolocation |
|---|---|---|---|
| User IP | 3.147.66.178 | This is not retrieved for now | Country: United States (US) City: Postal code: Latitude: 37.751 Longitude: -97.822 Network: 3.144.0.0/12 |
| Server IP | Autonomous System (AS) #: 201964 BGP prefix: 31.187.84.0/22 Country Code: FI Registry: ripencc Allocated: 2011-03-25 Info: EURONIC, FI | Country: Finland (FI) State: Uusimaa (18) City: Vantaa Postal code: 01620 Latitude: 60.2799 Longitude: 24.8537 Network: 31.187.84.0/22 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud for teidentukko.fi
Source: Actual web page - Timestamp: 2022-09-19 10:13Notice: Miscellaneous words removed from the cloud to enhance the analytics
Web page details for teidentukko.fi
Source: Actual web page - Timestamp: 2022-02-08 19:55| Header data & Meta tags | title Petax Rent Matkailuautovuokraus Järvenpäässä not_found text/html; charset=UTF-8 |
| Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
| Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
| Cascading Style Sheets (CSS) (CSS) | |
| Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
| JavaScript libraries |
Cookie data for teidentukko.fi
Source: Actual web page - Timestamp: 2022-02-08 19:55Number of cookies: 0
| Cookie domain | Cookie values |
|---|
Screenshot for teidentukko.fi
Source: Actual web page - Timestamp: 2022-09-19 10:13
DNS records for teidentukko.fi
Source: DNS reponse - Timestamp: 2022-09-19 10:13| A | teidentukko.fi 185.55.85.123 (Time to Live: 600) |
| NS | ns3.euronic.fi
|
| SOA | teidentukko.fi ns1.euronic.fi (Time to Live: 600) hostmaster.euronic.fi |
Whois record history for teidentukko.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
| Date | 2021-06-23 | 2022-05-25 | 2023-05-25 |
|---|---|---|---|
| Name | teidentukko.fi | teidentukko.fi | teidentukko.fi |
| State | Registered | Registered | Registered |
| Holder | Petax Oy | Petax Oy | Petax Oy |
| Address | Puurtajankuja 3D 50 | Puurtajankuja 3D 50 | Puurtajankuja 3D 50 |
| Country | Finland (FI) | Finland (FI) | Finland (FI) |
| GrantDate | 2021-06-23T18:37:50.67 | 2021-06-23T18:37:50.67 | 2021-06-23T18:37:50.67 |
| Registrar | Euronic Oy | Euronic Oy | Euronic Oy |
| PostalArea | Järvenpää | Järvenpää | Järvenpää |
| PostalCode | 04440 | 04440 | 04440 |
| NameServer1 | ns1.euronic.fi | ns1.euronic.fi | ns1.euronic.fi |
| NameServer2 | ns2.euronic.fi | ns2.euronic.fi | ns2.euronic.fi |
| NameServer3 | ns3.euronic.fi | ns3.euronic.fi | ns3.euronic.fi |
| PhoneNumber | |||
| IsDNSSecInUse | no | no | no |
| OrganizationId | 2589601-8 | 2589601-8 | 2589601-8 |
| AssociationType | Company | Company | Company |
| LastValidityDate | 2022-06-23T18:37:50.67 | 2023-06-23T18:37:50.67 | 2024-06-23T18:37:50.67 |
| DepartmentOrContactPerson |
Server response for teidentukko.fi
Source: Web server reponse - Timestamp: 2022-09-19 10:13| Final URL | https://petaxrent.fi/ |
| HTTP Return Code | HTTP/1.1 200 OK |
| IP Address | 31.187.84.51 Autonomous System (AS) #: 201964 BGP prefix: 31.187.84.0/22 Country Code: Finland (FI) Registry: ripencc Allocated: 2011-03-25 Info: EURONIC, FI |
| Server Header | Server: Nginx Via: |
| Certificate | Issued By: Sectigo Limited Issuer details: O=Sectigo Limited, United Kingdom (GB) Issuer details: CN=Sectigo RSA Domain Validation Secure Server CA Version: 2 Algorithm: RSA-SHA256 Issued On: 2022-02-11 00:00:00 Expires On: 2023-02-12 00:00:00 |
| Certificate Subject | Country (C): Location (L): Organization (O): Common Name (CN): www.petaxrent.fi |
| Certificate Alternative Names | www.petaxrent.fi petaxrent.fi |
Used technologies on teidentukko.fi
Source: Web page analysis - Timestamp: 2022-09-19 10:13| Latest review | 2022-09-19 10:13 |
| Page language (from header) | (This is often false!) |
| Technologies |
Known subdomains for teidentukko.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700Number of subdomains found: 11
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 11
| Domain name | Final URL (when last tested) | Links | Last validity |
|---|---|---|---|
| brilliancytaxi.fi | Expired 2022-01-12 | ||
| jarvenpaantaksiammattilaiset.fi | No DNS records found | 2024-07-03 | |
| loistotaksi.fi | Expired 2022-01-12 | ||
| petax.fi | http://petax.fi/ | 2025-02-12 | |
| petaxlahti.fi | http://petaxlahti.fi/ | 2024-11-27 | |
| petaxrent.fi | No DNS records found | 2024-06-16 | |
| petterintaksi.fi | http://www.petterintaksi.fi/ | 2025-02-01 | |
| taksille.fi | No DNS records found | 2025-06-05 | |
| taxibrilliancy.fi | Expired 2022-01-12 | ||
| teidentukko.fi | https://petaxrent.fi/ | 2024-06-23 | |
| varataksit.fi | http://petaxlahti.fi/ | 2025-02-13 |