salonsaxin.fi  


Details
 
Server IP geolocation
 
Word cloud
 
Web page details & SOME
 
Cookie data
 
Screenshot
 
DNS records
 
Whois history
 
Server response
 
Used technologies
 
Subdomains
 
Hosting
 
Holders domains
 


Details

Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)
StateRegistered
Holder Kievarinkatu 5, Finland

Grant Date2020-05-15
Last Validity Date2025-05-15
RegistrarINT2000 Oy
38840 Niinisalo
Name Servers
Please see DNS section for details
ns1.int2000.net
ns2.int2000.net
Is The DNSSec in Use No
IANA details for suffixTop Level Domain (TLD): FI
TLD manager: Finnish Transport and Communications Agency Traficom
Domain type: Country-code



Server IP location

Source: Actual web page - Timestamp: 2022-10-07 00:52
WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP sourceIP addressASN block dataIP Geolocation
User IP34.236.191.0This is not retrieved for nowCountry: United States   (US)
State: Virginia (VA)
City: Ashburn
Postal code: 20149
Latitude: 39.0481
Longitude: -77.4728
Network: 34.236.0.0/16
Server IPAutonomous System (AS) #: 35382
BGP prefix: 83.143.216.0/21
Country Code: FI
Registry: ripencc
Allocated: 2005-07-18
Info: CAPNOVA-AS, FI
Country: Finland   (FI)
State: Pirkanmaa (11)
City: Tampere
Postal code: 33200
Latitude: 61.4947
Longitude: 23.7523
Network: 83.143.216.0/21

This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.



Word cloud for salonsaxin.fi

Sorry, not enough data to parse a word cloud for this site at this time



Web page details for salonsaxin.fi

Source: Actual web page - Timestamp: 2022-12-01 19:05
Header data & Meta tagstitle Kampaamo Nokia - SALON SAXIN Kampaaja Nokia
robots index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1
viewport width=device-width, initial-scale=1
generator WordPress 6.0.3
not_found emptyfi_FI. website. Kampaamo Nokia - SALON SAXIN Kampaaja Nokia. Kampaamo- ja parturipalveluja ammattitaidolla. Olemme ajan hermolla ja meille ovat kaikki tervetulleita! Nokia, kampaaja, parturi, parranajo, leikkuut, värjäys, permanentti, teippipidennykset, kestovärit.. https://salonsaxin.fi/. SALON SAXIN. https://www.facebook.com/Salon-Saxin-101774661618612/. 2022-02-05T18:45:58+00:00. https://salonsaxin.fi/wp-content/uploads/2020/08/Kopio_-saxin_ajan.png.
description Kampaamo- ja parturipalveluja ammattitaidolla. Olemme ajan hermolla ja meille ovat kaikki tervetulleita! Nokia, kampaaja, parturi, parranajo, leikkuut, värjäys, permanentti, teippipidennykset, kestovärit.
msapplication-tileimage https://salonsaxin.fi/wp-content/uploads/2020/07/cropped-Salon3-270x270.png
google-site-verification GABnUEbf4PxZzNrDyNzXT0ImhLO6Ur4rKxGdYjYyLh0
Open Graph (OG) meta tagsog:url https://salonsaxin.fi/
og:type website
og:image https://salonsaxin.fi/wp-content/uploads/2020/08/Kopio_-saxin_ajan.png
og:title Kampaamo Nokia - SALON SAXIN Kampaaja Nokia
og:locale fi_FI
og:site_name SALON SAXIN
og:description Kampaamo- ja parturipalveluja ammattitaidolla. Olemme ajan hermolla ja meille ovat kaikki tervetulleita! Nokia, kampaaja, parturi, parranajo, leikkuut, värjäys, permanentti, teippipidennykset, kestovärit.
Twitter cardstwitter:card summary_large_image
twitter:data1 4 minuuttia
twitter:label1 Arvioitu lukuaika
Cascading Style Sheets (CSS) (CSS)https://salonsaxin.fi/wp-content/themes/olsen-light/style.min.css?ver=1.7.0
https://salonsaxin.fi/wp-content/plugins/elementor/assets/lib/font-awesome/css/fontawesome.min.css?ver=5.15.3
https://fonts.googleapis.com/css?family=roboto%3a100%2c100italic%2c200%2c200italic%2c300%2c300italic%2c400%2c400italic%2c500%2c500italic%2c600%2c600italic%2c700%2c700italic%2c800%2c800italic%2c900%2c900italic%7croboto+slab%3a100%2c100italic%2c200%2c200italic%2c300%2c300italic%2c400%2c400italic%2c500%2c500italic%2c600%2c600italic%2c700%2c700italic%2c800%2c800italic%2c900%2c900italic&display=auto&ver=6.0.3
https://salonsaxin.fi/wp-content/themes/olsen-light/vendor/olsen-icons/css/olsen-icons.min.css?ver=1.7.0
https://salonsaxin.fi/wp-content/plugins/elementor/assets/lib/eicons/css/elementor-icons.min.css?ver=5.15.0
https://salonsaxin.fi/wp-content/uploads/elementor/css/post-11.css?ver=1604001399
https://salonsaxin.fi/wp-content/plugins/elementor/assets/lib/animations/animations.min.css?ver=3.6.8
https://salonsaxin.fi/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.6.1
https://salonsaxin.fi/wp-content/uploads/elementor/css/post-5.css?ver=1644086761
https://salonsaxin.fi/wp-content/themes/olsen-light/vendor/simple-lightbox/simple-lightbox.min.css?ver=2.7.0
https://salonsaxin.fi/wp-content/plugins/elementor/assets/lib/font-awesome/css/solid.min.css?ver=5.15.3
https://salonsaxin.fi/wp-content/plugins/ultimate-responsive-image-slider/assets/css/slider-pro.css?ver=6.0.3
https://salonsaxin.fi/wp-content/plugins/elementor/assets/lib/font-awesome/css/regular.min.css?ver=5.15.3
https://salonsaxin.fi/wp-content/plugins/elementor/assets/css/frontend-legacy.min.css?ver=3.6.8
https://salonsaxin.fi/wp-includes/css/dist/block-library/style.min.css?ver=6.0.3
https://salonsaxin.fi/wp-content/plugins/wp-my-instagram/css/style.css?ver=1.0
https://salonsaxin.fi/wp-content/plugins/elementor/assets/css/frontend.min.css?ver=3.6.8
https://salonsaxin.fi/wp-content/uploads/elementor/css/global.css?ver=1604001399
Social Media (SOME) links  Facebook: https://www.facebook.com/Salon-Saxin-101774661618612
  Instagram: https://www.instagram.com/salonsaxin/
JavaScript librarieshttps://salonsaxin.fi/wp-content/themes/olsen-light/js/scripts.min.js?ver=1.7.0
https://salonsaxin.fi/wp-includes/js/jquery/jquery.min.js?ver=3.6.0
https://salonsaxin.fi/wp-content/plugins/elementor/assets/js/preloaded-modules.min.js?ver=3.6.8
https://salonsaxin.fi/wp-content/plugins/elementor/assets/js/webpack.runtime.min.js?ver=3.6.8
https://salonsaxin.fi/wp-content/plugins/elementor/assets/js/frontend-modules.min.js?ver=3.6.8
https://salonsaxin.fi/wp-content/plugins/elementor/assets/lib/swiper/swiper.min.js?ver=5.3.6
https://salonsaxin.fi/wp-content/plugins/elementor/assets/lib/dialog/dialog.min.js?ver=4.9.0
https://connect.facebook.net/fi_fi/sdk.js#xfbml=1&version=v7.0
https://salonsaxin.fi/wp-content/plugins/elementor/assets/lib/waypoints/waypoints.min.js?ver=4.0.2
https://salonsaxin.fi/wp-includes/js/dist/vendor/regenerator-runtime.min.js?ver=0.13.9
https://salonsaxin.fi/wp-content/plugins/elementor/assets/lib/share-link/share-link.min.js?ver=3.6.8
https://salonsaxin.fi/wp-content/plugins/elementor/assets/js/frontend.min.js?ver=3.6.8
https://salonsaxin.fi/wp-content/themes/olsen-light/vendor/simple-lightbox/simple-lightbox.min.js?ver=2.7.0
https://salonsaxin.fi/wp-includes/js/jquery/ui/core.min.js?ver=1.13.1
https://salonsaxin.fi/wp-content/plugins/ultimate-responsive-image-slider/assets/js/jquery.sliderpro.js?ver=1.5.0
https://salonsaxin.fi/wp-content/themes/olsen-light/js/simple-lightbox-init.min.js?ver=1.7.0
https://salonsaxin.fi/wp-includes/js/dist/vendor/wp-polyfill.min.js?ver=3.15.0
https://salonsaxin.fi/wp-includes/js/jquery/jquery-migrate.min.js?ver=3.3.2
https://salonsaxin.fi/wp-content/plugins/contact-form-7/includes/js/index.js?ver=5.6.1
https://salonsaxin.fi/wp-content/themes/olsen-light/js/search-init.min.js?ver=1.7.0



Cookie data for salonsaxin.fi

Source: Actual web page - Timestamp: 2022-12-01 19:05
Number of cookies: 0
Cookie domainCookie values



Screenshot for salonsaxin.fi

Source: Actual web page - Timestamp: 2022-10-07 00:52
Screenshot for salonsaxin.fi



DNS records for salonsaxin.fi

Source: DNS reponse - Timestamp: 2022-10-07 00:52
Asalonsaxin.fi    83.143.218.118  (Time to Live: 3599)
MXsalonsaxin.fi (Time to Live: 3600)
NSns4.capnova.comns3.capnova.com
SOAsalonsaxin.fi    ns3.capnova.com (Time to Live: 14400)
penina\.peltonen.mediasade.fi
TXTSPF records:
v=spf1
+a
+mx
+ip4:83.143.218.118
~all



Whois record history for salonsaxin.fi

Source: Finnish Transport and Communications Agency (Traficom)
Showing latest max 5 detected changes in the records. Changes are highlighted
Date2022-10-282023-04-162023-10-282024-05-162024-05-19
Name salonsaxin.fi salonsaxin.fi salonsaxin.fi salonsaxin.fi salonsaxin.fi
State Registered Registered Registered Validity expired Registered
Holder www design www design www design www design www design
Address Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5
Country   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)
GrantDate 2020-05-15T15:10:51.11 2020-05-15T15:10:51.11 2020-05-15T15:10:51.11 2020-05-15T15:10:51.11 2020-05-15T15:10:51.11
Registrar Domain247 Domain247 INT2000 Oy INT2000 Oy INT2000 Oy
PostalArea Niinisalo Niinisalo Niinisalo Niinisalo Niinisalo
PostalCode 38840 38840 38840 38840 38840
NameServer1 ns1.domain247.fi ns1.domain247.fi ns1.int2000.net ns1.int2000.net ns1.int2000.net
NameServer2 ns2.domain247.fi ns2.domain247.fi ns2.int2000.net ns2.int2000.net ns2.int2000.net
PhoneNumber     
IsDNSSecInUse no  no  no  no  no
OrganizationId 2503281-8 2503281-8 2503281-8 2503281-8 2503281-8
AssociationType Company Company Company Company Company
LastValidityDate 2023-05-15T15:10:51.11 2024-05-15T15:10:51.11 2024-05-15T15:10:51.11 2024-05-15T15:10:51.11 2025-05-15T15:10:51.11
DepartmentOrContactPerson     



Server response for salonsaxin.fi

Source: Web server reponse - Timestamp: 2022-10-07 00:52
Final URLhttp://www.salonsaxin.fi/
HTTP Return CodeHTTP/1.0 301 Moved Permanently
IP Address
83.143.218.118 
Autonomous System (AS) #: 35382
BGP prefix: 83.143.216.0/21
Country Code:  Finland (FI)
Registry: ripencc
Allocated: 2005-07-18
Info: CAPNOVA-AS, FI
Server HeaderServer:
Via:
Certificate Not available
Using certificate is highly recommended for Search Engine Optimization (SEO)
If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address



Used technologies on salonsaxin.fi

Source: Web page analysis - Timestamp: 2022-10-07 00:52
Latest review2022-10-07 00:52
Page language (from header)en (This is often false!)
TechnologiesApache Apache (Web Servers) (100% propable)
Bootstrap Bootstrap (UI Frameworks) (100% propable)



Known subdomains for salonsaxin.fi

Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700
No subdomains found



Web hosting providers

Source: All valid company websites with content (see below table)



Domains owned by same owner (current and past)

Source: Finnish Transport and Communications Agency (Traficom)
Number of domains: 161
Domain nameFinal URL
(when last tested)
LinksLast validity
4321.fi  
Details
Screenshot
Expired 2022-01-11
ad-kpaa.fi No DNS records found  
Details
2025-04-20
africar.fi No DNS records found  
Details
2025-02-12
ahofarm.fi  
Details
Expired 2000-12-31
airportpark.fi http://www.airportpark.fi/  
Details
Screenshot
2025-01-16
ammattikalastusmessut.fi No DNS records found  
Details
2025-03-14
auto-sabo.fi http://www.auto-sabo.fi/  
Details
Screenshot
2024-08-06
autosabo.fi http://www.autosabo.fi/  
Details
Screenshot
2024-08-06
avainauto.fi  
Details
Screenshot
Expired 2022-07-31
benzboy.fi  
Details
Expired 2018-08-14
design-suomi.fi  
Details
Screenshot
Expired 2019-10-23
discgolfstore.fi https://www.frisbeegolf-forum.fi/  
Details
Screenshot
2025-02-08
driveit.fi  
Details
Screenshot
Expired 2020-01-22
elinvoimainenkankaanpaa.fi  
Details
Screenshot
Expired 2023-09-06
eurogarment.fi  
Details
Screenshot
Expired 2020-07-05
fixus-kankaanpaa.fi  
Details
Screenshot
Expired 2023-03-31
frisbeegolf-forum.fi http://www.frisbeegolf-forum.fi/  
Details
Screenshot
2025-01-01
frisbeegolfkauppa.fi http://www.frisbeegolfkauppa.fi/  
Details
Screenshot
2025-02-08
futsalforum.fi http://www.futsalforum.fi/  
Details
Screenshot
2024-12-13
geopark-suomi.fi  
Details
Expired 2023-04-30
grillivaunut.fi http://www.grillivaunut.fi/  
Details
Screenshot
2025-01-18
hatax.fi No DNS records found  
Details
2024-12-03
hennakyrojoki.fi No DNS records found  
Details
2025-01-26
hevosenhetki.fi  
Details
Screenshot
Expired 2021-05-25
hotellitoholampi.fi  
Details
Screenshot
Expired 2019-08-14
ideaparkopen.fi No DNS records found  
Details
2025-04-08
ilmalampopumppukauppa.fi http://www.ilmalampopumppukauppa.fi/  
Details
Screenshot
2024-06-14
ilmavideot.fi http://www.ilmavideot.fi/  
Details
Screenshot
2024-08-26
itpaja.fi  
Details
Screenshot
Expired 2020-03-23
itpalvelukallionkieli.fi  
Details
Screenshot
Expired 2020-05-02
jaanantaksi.fi No DNS records found  
Details
2024-12-13
jk-inks.fi  
Details
Expired 2018-12-10
jvsahkoasennus.fi http://www.jvsahkoasennus.fi/  
Details
Screenshot
2024-08-04
jvsähköasennus.fi http://www.xn--jvshkasennus-icb8w.fi/  
Details
Screenshot
2024-08-04
kalastustukku.fi  
Details
Screenshot
Expired 2024-01-22
kama1958.fi http://www.kama1958.fi/  
Details
Screenshot
2024-06-14
kangasfysio.fi  
Details
Screenshot
Expired 2020-02-04
kankaanpaanautohuolto.fi No DNS records found  
Details
2025-03-10
kankaanpaanjoulu.fi  
Details
Screenshot
Expired 2019-11-02
kankaanpäänjoulu.fi  
Details
Screenshot
Expired 2019-11-02
kankaanpaanlasi.fi https://xn--kankaanpnlasi-ifba.fi/  
Details
Screenshot
2024-12-13
kankaanpäänlasi.fi https://xn--kankaanpnlasi-ifba.fi/  
Details
Screenshot
2024-08-26
kankaanpaanmetsastysyhdistys.fi No DNS records found  
Details
2024-11-22
kankaanpäänmetsastysyhdistys.fi http://kankaanpaanmetsastysyhdistys.fi/  
Details
Screenshot
2024-11-22
kankaanpäänmetsästysyhdistys.fi http://kankaanpaanmetsastysyhdistys.fi/  
Details
Screenshot
2025-02-26
kankaanpaanomaishoitajat.fi http://www.kankaanpaanomaishoitajat.fi/  
Details
Screenshot
2025-02-01
katalysaattorit.fi http://www.katalysaattorit.fi/  
Details
Screenshot
2025-02-19
katsastusasemat.fi  
Details
Screenshot
Expired 2024-03-26
kaupunkiseikkailu.fi  
Details
Expired 2024-05-10
keilailuliitto.fi http://www.keilailuliitto.fi/  
Details
Screenshot
2025-01-15
kerola.fi http://www.kerola.fi/  
Details
Screenshot
2025-01-16
keskofood.fi http://www.keskofood.fi/  
Details
2025-01-15
kesyry.fi https://kesyry.fi/  
Details
Screenshot
2025-03-22
kiikanwallin.fi No DNS records found  
Details
2024-07-30
konsulentit.fi No DNS records found  
Details
2024-08-27
konsulentti.fi http://dan.com/buy-domain/konsulentti.fi?redirected=true  
Details
Screenshot
2024-08-27
koota.fi No DNS records found  
Details
2025-01-15
kotiyleiso.fi  
Details
Screenshot
Expired 2019-06-21
kpaalasi.fi http://www.kpaalasi.fi/  
Details
Screenshot
2025-02-17
kuninkaanlahde.fi https://www.design.yt/  
Details
Screenshot
2025-03-19
kuninkaanlähde.fi http://www.xn--kuninkaanlhde-kfb.fi/  
Details
Screenshot
2025-03-03
kuntoutuskumppani.fi No DNS records found  
Details
2024-09-29
kuntoutuspaikkasi.fi No DNS records found  
Details
2025-01-13
kyrojoki.fi No DNS records found  
Details
2025-01-27
laboratoriotarvike.fi  
Details
Screenshot
Expired 2023-02-03
lammoneriste.fi  
Details
Screenshot
Expired 2023-02-02
lämmöneriste.fi  
Details
Screenshot
Expired 2023-02-02
lämpöpumppukauppa.fi https://wattila.fi/  
Details
Screenshot
2025-01-30
lampopumppukeskus.fi  
Details
Screenshot
Expired 2024-02-25
lampopumppuvaraosat.fi No DNS records found  
Details
2025-01-16
lauantaitorit.fi https://design.yt/  
Details
Screenshot
2025-04-05
lekatec.fi  
Details
Screenshot
Expired 2021-07-30
lelesb.fi http://www.lelesb.fi/  
Details
Screenshot
2024-08-11
lemppu.fi http://www.lemppu.fi/  
Details
Screenshot
2024-05-25
lemppulegends.fi No DNS records found  
Details
2024-08-25
leppisfishing.fi  
Details
Screenshot
Expired 2022-03-26
levinhenkireika.fi https://levinhenkireika.fi/  
Details
Screenshot
2025-05-02
löytökorpi.fi No DNS records found  
Details
2025-03-17
maila.fi http://www.maila.fi/  
Details
Screenshot
2025-02-22
meggala.fi  
Details
Screenshot
Expired 2021-12-27
metsastyskeskustelu.fi  
Details
Screenshot
Expired 2024-01-22
mkenergiakuljetus.fi No DNS records found  
Details
2024-08-14
mm-kaupat.fi https://www.nettiauto.com/yritys/343149  
Details
Screenshot
2024-06-06
monioljypoltin.fi  
Details
Screenshot
Expired 2024-05-21
monioljypolttimenvaraosat.fi http://www.monioljypolttimenvaraosat.fi/  
Details
Screenshot
2024-11-16
monioljypolttimet.fi https://www.monioljypolttimet.fi/  
Details
Screenshot
2024-08-26
mpvarikko.fi  
Details
Screenshot
Expired 2021-05-03
murskamies.fi http://www.murskamies.fi/  
Details
Screenshot
2024-12-30
myyntivaunut.fi https://www.myyntivaunut.fi/  
Details
Screenshot
2024-05-30
neoen.fi http://www.neoen.fi/  
Details
Screenshot
2024-09-29
neoen-finland.fi http://www.neoen-finland.fi/  
Details
Screenshot
2024-09-29
nesvuokrapelit.fi  
Details
Screenshot
Expired 2000-12-31
nettipalvelin.fi http://www.nettipalvelin.fi/  
Details
Screenshot
2025-01-11
nettipertti.fi http://design.yt/  
Details
2024-12-02
nibevaraosat.fi No DNS records found  
Details
2025-01-16
nonstopparturi.fi http://www.nonstopparturi.fi/  
Details
Screenshot
2024-12-03
northecoclean.fi  
Details
Screenshot
Expired 2021-09-29
nuhvi.fi https://www.nuhvi.fi/index.php/fi/  
Details
Screenshot
2025-02-25
ohjelmasiili.fi  
Details
Screenshot
Expired 2019-08-24
öljysäiliö.fi  
Details
Screenshot
Expired 2022-03-25
olkimix.fi  
Details
Screenshot
Expired 2019-06-26
oulunautohuolto.fi http://www.oulunautohuolto.fi/  
Details
Screenshot
2025-01-22
oxdog.fi http://www.oxdog.fi/  
Details
Screenshot
2024-11-20
pauliinap.fi  
Details
Screenshot
Expired 2000-12-31
pe-53.fi  
Details
Expired 2019-01-01
pelaajaboardcast.fi https://pelaajaboardcast.fi/  
Details
Screenshot
2024-10-07
pesapalloforum.fi http://www.pesapalloforum.fi/  
Details
Screenshot
2025-01-18
pesisforum.fi No DNS records found  
Details
2026-01-18
pesisportaali.fi http://www.pesisportaali.fi/  
Details
Screenshot
2025-01-05
pienisuuriidea.fi https://pienisuuriidea.fi/  
Details
Screenshot
2024-10-15
pirkanmaanpohjarakennus.fi https://pirkanmaanpohjarakennus.fi/  
Details
Screenshot
2024-09-23
pomarkunpyry.fi https://design.yt/  
Details
Screenshot
2025-03-09
pompy.fi https://design.yt/  
Details
Screenshot
2025-03-09
porintilausajo.fi http://www.porintilausajo.fi/  
Details
Screenshot
2025-01-15
ps82.fi  
Details
Expired 2018-03-07
putkiasennusta.fi  
Details
Screenshot
Expired 2023-01-22
rajalamotorsport.fi  
Details
Screenshot
Expired 2024-04-30
rakennuskiviranta.fi  
Details
Screenshot
Expired 2020-03-02
rakennuspalvelujarvinen.fi No DNS records found  
Details
2025-04-21
reseptikilpailu.fi  
Details
Expired 2021-12-06
retkilemi.fi No DNS records found  
Details
2024-08-03
roskala.fi  
Details
Screenshot
Expired 2000-12-31
rudanco.fi https://rudanco.fi/  
Details
Screenshot
2024-08-09
sahkomopo.fi No DNS records found  
Details
2025-01-15
sähkösun.fi http://www.xn--shksun-bua0m.fi/  
Details
2024-07-27
salibandyforum.fi http://www.salibandyforum.fi/  
Details
Screenshot
2025-01-04
salonsaxin.fi http://www.salonsaxin.fi/  
Details
Screenshot
2025-05-15
sarmeen.fi http://www.sarmeen.fi/  
Details
Screenshot
2024-05-25
satakunnantaksi.fi  
Details
Screenshot
Expired 2024-03-24
satakunnantieisannointi.fi https://satakunnantieisannointi.fi/  
Details
Screenshot
2025-03-05
satakunnanurheiluklinikka.fi  
Details
Screenshot
Expired 2021-09-13
sillanmaki.fi https://www.sillanmaki.fi/  
Details
Screenshot
2024-12-11
sinituuli.fi http://www.sinituuli.fi/  
Details
Screenshot
2025-01-16
snowracers.fi  
Details
Screenshot
Expired 2023-09-12
solarsuomi.fi https://www.solar.eu/  
Details
Screenshot
2025-01-15
suomenravintolalaite.fi https://suomenravintolalaite.fi/  
Details
Screenshot
2024-09-06
tacogarcia.fi  
Details
Screenshot
Expired 2022-01-05
taksileponiemi.fi http://www.taksileponiemi.fi/  
Details
Screenshot
2024-12-14
tapahtumaviikko.fi  
Details
Screenshot
Expired 2023-01-22
teollisuusimuri.fi  
Details
Screenshot
Expired 2023-03-11
tiinajalasse.fi  
Details
Expired 2019-02-26
tilataksipori.fi https://tilataksipori.fi/  
Details
Screenshot
2025-02-12
tomoottajat.fi http://www.tomoottajat.fi/  
Details
Screenshot
2025-03-19
traktoripalvelu.fi http://www.traktoripalvelu.fi/  
Details
Screenshot
2025-01-16
trukkikortti.fi  
Details
Screenshot
Expired 2022-03-26
turunsinappi.fi https://www.turunsinappia.fi/  
Details
Screenshot
2025-01-15
unf.fi http://www.unf.fi/  
Details
Screenshot
2025-01-15
valokuvaajapauliinap.fi  
Details
Screenshot
Expired 2000-12-31
varastoon.fi https://www.tilacenter.fi/  
Details
Screenshot
2024-08-19
varisuora.fi http://www.varisuora.fi/  
Details
Screenshot
2025-01-16
verkkokauppakorpela.fi http://www.verkkokauppakorpela.fi/  
Details
Screenshot
2024-11-16
vervevara.fi  
Details
Screenshot
Expired 2023-06-20
vientiautot.fi https://www.vientiautot.fi/  
Details
Screenshot
2025-05-10
vihapulla.fi No DNS records found  
Details
2025-01-26
vikailmoitukset.fi http://www.vikailmoitukset.fi/  
Details
Screenshot
2025-01-16
vikapihalle.fi  
Details
Screenshot
Expired 2021-10-11
volvo-ohjelmointi.fi  
Details
Expired 2022-10-21
volvoohjelmointi.fi  
Details
Screenshot
Expired 2022-10-21
wwwdesign.fi http://www.wwwdesign.fi/  
Details
Screenshot
2025-01-11
yli-rami.fi http://www.yli-rami.fi/  
Details
Screenshot
2025-02-08
yritysesittelyvideo.fi http://www.yritysesittelyvideo.fi/  
Details
Screenshot
2025-01-22