oga.fi  


Details
 
Server IP geolocation
 
Word cloud
 
Web page details & SOME
 
Cookie data
 
Screenshot
 
DNS records
 
Whois history
 
Server response
 
Used technologies
 
Subdomains
 
Hosting
 
Holders domains
 


Details

Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)
StateRegistered
Holder Pyynikintori 1 A 26, Finland

Grant Date2017-05-24
Last Validity Date2024-05-24
RegistrarGandi SAS
33230 Tampere
Name Servers
Please see DNS section for details
ns-136-c.gandi.net
ns-233-a.gandi.net
ns-87-b.gandi.net
Is The DNSSec in Use No
IANA details for suffixTop Level Domain (TLD): FI
TLD manager: Finnish Transport and Communications Agency Traficom
Domain type: Country-code



Server IP location

Source: Actual web page - Timestamp: 2022-11-05 19:38
WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP sourceIP addressASN block dataIP Geolocation
User IP3.235.172.123This is not retrieved for nowCountry: United States   (US)
State: Virginia (VA)
City: Ashburn
Postal code: 20149
Latitude: 39.0481
Longitude: -77.4728
Network: 3.224.0.0/12
Server IPAutonomous System (AS) #: 39242
BGP prefix: 81.19.112.0/20
Country Code: FI
Registry: ripencc
Allocated: 2005-11-15
Info: SECLAN, FI
Country: Finland   (FI)
State: Pirkanmaa (11)
City: Tampere
Postal code: 33720
Latitude: 61.4492
Longitude: 23.8557
Network: 81.19.112.0/21

This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.



Word cloud for oga.fi

Source: Actual web page - Timestamp: 2022-11-05 19:38
Notice: Miscellaneous words removed from the cloud to enhance the analytics



Web page details for oga.fi

Source: Actual web page - Timestamp: 2022-12-02 03:40
Header data & Meta tagstitle ÖGA - Pieni kirurginen silmäsairaala Ratina Tampere
robots index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1
viewport width=device-width, initial-scale=1
generator WordPress 5.8.6
not_found emptyfi_FI. website. ÖGA - Pieni kirurginen silmäsairaala Ratina Tampere. https://oga.fi/. ÖGA – Pieni kirurginen silmäsairaala. https://www.facebook.com/ogasairaala/. 2019-01-11T10:33:10+00:00.
theme-color #ffffff
format-detection telephone=no
msapplication-tilecolor #da532c
facebook-domain-verification 63bl3btm5l5ibv3d8jisem7v0w9vpe
Open Graph (OG) meta tagsog:url https://oga.fi/
og:type website
og:title ÖGA - Pieni kirurginen silmäsairaala Ratina Tampere
og:locale fi_FI
og:site_name ÖGA – Pieni kirurginen silmäsairaala
Twitter cardstwitter:card summary_large_image
Cascading Style Sheets (CSS) (CSS)/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.5.6.1
https://fonts.googleapis.com/css?family=roboto+condensed:400,400i,700
/wp-content/themes/oga/style.css?v=1.4
/wp-content/plugins/simple-tooltips/zebra_tooltips.css?ver=5.8.6
https://oga.fi/wp-includes/css/dist/block-library/style.min.css?ver=5.8.6
/wp-content/plugins/consent-magic-pro/assets/css/style-public.min.css?ver=1.0.0
Social Media (SOME) links  Facebook: https://www.facebook.com/oga.silmasairaala/
  Instagram: https://www.instagram.com/oga.silmasairaala/
JavaScript libraries/wp-content/plugins/pixelyoursite-pro/dist/scripts/js.cookie-2.1.3.min.js?ver=2.1.3
/wp-content/plugins/pixelyoursite-pro/dist/scripts/public.js?ver=9.3.3
/wp-content/themes/oga/js/scripts.js
https://oga.fi/wp-includes/js/jquery/jquery-migrate.min.js?ver=3.3.2
data:text/javascript;base64,ci8qidwhw0neqvrbwyaqlwp2yxigq1nfrgf0ysa9ihsibm5fy29va2llx2lkcyi6w10sim5vbl9uzwnlc3nhcnlfy29va2llcyi6w10simnvb2tpzwxpc3qionsindqionsidgvybv9pzci6ndqsim5hbwuioijwxhuwmgu0bhr0xhuwmgu0bvx1mdblnhr0xhuwmgy2bvx1mdblnhqifswinduionsidgvybv9pzci6ndusim5hbwuioijbbmfsexrpawtrysj9lci0nii6eyj0zxjtx2lkijo0niwibmftzsi6ik1hcmtraw5vaw50asj9lci0nyi6eyj0zxjtx2lkijo0nywibmftzsi6ikdvb2dszsbgb250cyj9lci0oci6eyj0zxjtx2lkijo0ocwibmftzsi6ilvuyxnzawduzwqifswindkionsidgvybv9pzci6ndksim5hbwuioijvcg90zxr1dcb2awrlb3qifx0simfqyxhfdxjsijoiahr0chm6xc9cl29nys5mavwvd3atywrtaw5cl2fkbwlulwfqyxgucghwiiwiy3vycmvudf9syw5nijoizmkilcjzzwn1cml0esi6ijg4zgjlzde5nmiilcjjb25zzw50vmvyc2lvbii6ijeilcjjb29rawveb21haw4ioiiilcjwcml2ywn5x2xlbmd0aci6iji1mcisimnzx2v4cglyzv9kyxlzijoimtgwiiwiy3nfc2nyaxb0x2nhdci6eyjmywnlym9vayi6ndysimfuywx5dgljcyi6ndusimdhzhmiojq2lcjwaw50zxjlc3qiojq2lcjiaw5nijo0niwiywrzzw5zzsi6ndusimh1ynnwb3qiojq2lcjtyxrvbw8iojq2lcjtyxbzijo0nswiywrkdghpcyi6ndusinnoyxjldghpcyi6ndusinnvdw5ky2xvdwqiojq2lcjzbglkzxnoyxjlijo0niwiaw5zdgfncmftijo0nswiag90amfyijo0niwidglrdg9rijo0niwiz29vz2xlzm9udhmiojq3fswiy3nfchjvb2zfzxhwaxjlijoimzywiiwiy3nfzgvmyxvsdf9jbg9zzv9vbl9zy3jvbgwioiiymcisimnzx3ryywnrx2fuywx5dgljcyi6ijailcj0zxn0x3byzwzpeci6iiisimnzx3jlznjlc2hfywz0zxjfy29uc2vudci6ijeiftskdmfyignzx2xvz19vymply3qgpsb7imfqyxh1cmwioijodhrwczpcl1wvb2dhlmzpxc93cc1hzg1pblwvywrtaw4tywphec5wahailcjub25jzsi6ijg2mmzkywvkngqiftsklyogxv0+icovcg==
/wp-content/plugins/simple-tooltips/zebra_tooltips.js?ver=5.8.6
https://oga.fi/wp-includes/js/dist/vendor/regenerator-runtime.min.js?ver=0.13.7
data:text/javascript;base64,y29uc29szs5sb2coj1bpegvsww91clnpdgugufjpihzlcnnpb24gos4zljmnkts=
/wp-content/plugins/contact-form-7/includes/js/index.js?ver=5.5.6.1
data:text/javascript;base64,ci8qidwhw0neqvrbwyaqlwp2yxigd3bjzjcgpsb7imfwasi6eyjyb290ijoiahr0chm6xc9cl29nys5mavwvd3atannvblwviiwibmftzxnwywnlijoiy29udgfjdc1mb3jtltdcl3yxin19owovkibdxt4gki8k
https://oga.fi/wp-includes/js/jquery/jquery.min.js?ver=3.6.0
data:text/javascript;base64,dqogicagicagicagicagicagicagigprdwvyeshmdw5jdglvbigpihsnciagicagicagicagicagicagicagicagicagicagicagicagicagicagicagicagia0kicagicagicagicagicagicagicagicagalf1zxj5kciudg9vbhrpchmgaw1niikuy2xvc2vzdcgilnrvb2x0axbziikuy3nzkcjkaxnwbgf5iiwgimlubgluzs1ibg9jayipow0kicagicagicagicagicagicagicanciagicagicagicagicagicagicagicagig5ldybquxvlcnkuwmvicmffvg9vbhrpchmoalf1zxj5kccudg9vbhrpchmnks5ub3qojy5jdxn0b21fbv9idwjibgunkswgew0kicagicagicagicagicagicagicagicagicagicdiywnrz3jvdw5kx2nvbg9yjzogicagiccjmzcyoti2jywnciagicagicagicagicagicagicagicagicagicany29sb3inogkjcqkni2zmzmzmzicsdqogicagicagicagicagicagicagicagicagicagj21hef93awr0acc6icazmdasdqogicagicagicagicagicagicagicagicagicagj29wywnpdhknoiagicauotusia0kicagicagicagicagicagicagicagicagicagicdwb3npdglvbic6icagicdyawdodccnciagicagicagicagicagicagicagicagih0pow0kicagicagicagicagicagicagicagicagdqogicagicagicagicagicagicagicagicagicagicagicagicagicagicagia0kicagicagicagicagicagicagicb9ktsnciagicagicagicagicagica=
data:text/javascript;base64,awyol2lqkghvbmv8b2r8ywqply50zxn0kg5hdmlnyxrvci5wbgf0zm9ybskpe3zhcib2pshuyxzpz2f0b3iuyxbwvmvyc2lvbikubwf0y2gol09tichczcspxyhczcspxz8oxgqrkt8vktt2zxi9w3bhcnnlsw50khzbmv0smtaplcbwyxjzzuludch2wzjdldewkswgcgfyc2vjbnqodlszxsb8fcawldewkv07fwvsc2v7dmvyptewo30gznvuy3rpb24gc2v0vmlkzw8okxtpzihkb2n1bwvudc5kb2n1bwvudevszw1lbnquy2xpzw50v2lkdgggpca3mjagfhwgdmvywzbdidwgmtape2rvy3vtzw50lmdldevszw1lbnrceulkkcj2awrlby1jb250ywluzxiiks5pbm5lckhutuw9jzxpbwcgc3jjpsivd3aty29udgvudc90agvtzxmvb2dhl3zpzgvvl29nys1pbnryby5nawyiigfsdd0iiib3awr0ad0inziwiibozwlnahq9ijq4mciglz4no31lbhnle2rvy3vtzw50lmdldevszw1lbnrceulkkcj2awrlby1jb250ywluzxiiks5pbm5lckhutuw9jzx2awrlbybpzd0iaw50cm8tdmlkzw8iigf1dg9wbgf5ig11dgvkigxvb3agcgxhexnpbmxpbmugchjlbg9hzd0iyxv0byigd2lkdgg9ije5mjaiighlawdodd0iodi4ij48c291cmnlihnyyz0il3dwlwnvbnrlbnqvdghlbwvzl29nys92awrlby9vz2etaw50cm8ud2vibsigdhlwzt0idmlkzw8vd2vibsi+phnvdxjjzsbzcmm9ii93cc1jb250zw50l3rozw1lcy9vz2evdmlkzw8vb2dhlwludhjvlm1wncigdhlwzt0idmlkzw8vbxa0ij48l3zpzgvvpic7fx1zzxrwawrlbygpo3dpbmrvdy5hzgrfdmvudexpc3rlbmvykcdyzxnpemunlgz1bmn0aw9ukgv2zw50kxtzzxrwawrlbygpo30pow==
//code.tidio.co/ivos0epfri2xaekgo6txjntiyosw9tja.js
data:text/javascript;base64,kgz1bmn0aw9ukhcszcxzlgwsasl7d1tsxt13w2xdfhxbxtt3w2xdlnb1c2goeydndg0uc3rhcnqnom5ldybeyxrlkckuz2v0vgltzsgplgv2zw50oidndg0uanmnfsk7dmfyigy9zc5nzxrfbgvtzw50c0j5vgfntmftzshzkvswxsxqpwquy3jlyxrlrwxlbwvudchzksxkbd1sit0nzgf0yuxhewvyjz8njmw9jytsoicno2ouyxn5bmm9dhj1zttqlnnyyz0nahr0chm6ly93d3cuz29vz2xldgfnbwfuywdlci5jb20vz3rtlmpzp2lkpscrastkbdtmlnbhcmvude5vzguuaw5zzxj0qmvmb3jlkgoszik7fskod2luzg93lgrvy3vtzw50lcdzy3jpchqnlcdkyxrhtgf5zxinlcdhve0tv1ruoujyqycpow==
/wp-content/plugins/pixelyoursite-super-pack/dist/scripts/public.js?ver=3.0.7
https://oga.fi/wp-includes/js/wp-embed.min.js?ver=5.8.6
/wp-content/plugins/consent-magic-pro/js/cs-public.min.js?ver=1.0.0
https://oga.fi/wp-includes/js/dist/vendor/wp-polyfill.min.js?ver=3.15.0
/wp-content/plugins/pixelyoursite-pro/dist/scripts/jquery.bind-first-0.2.3.min.js?ver=5.8.6



Cookie data for oga.fi

Source: Actual web page - Timestamp: 2022-12-02 03:40
Number of cookies: 13
Cookie domainCookie values
oga.fiCookie name: pys_session_limit
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 21 bytes
oga.fiCookie name: pys_start_session
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 21 bytes
oga.fiCookie name: pys_first_visit
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 19 bytes
oga.fiCookie name: pysTrafficSource
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 22 bytes
oga.fiCookie name: pys_landing_page
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 31 bytes
oga.fiCookie name: last_pysTrafficSource
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 27 bytes
oga.fiCookie name: last_pys_landing_page
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 36 bytes
oga.fiCookie name: _ga
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 30 bytes
oga.fiCookie name: _gid
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 31 bytes
oga.fiCookie name: _dc_gtm_UA-61972185-2
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 22 bytes
oga.fiCookie name: _fbp
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 32 bytes
youtube.comCookie name: YSC
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 14 bytes
youtube.comCookie name: VISITOR_INFO1_LIVE
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 29 bytes



Screenshot for oga.fi

Source: Actual web page - Timestamp: 2022-11-05 19:38
Screenshot for oga.fi



DNS records for oga.fi

Source: DNS reponse - Timestamp: 2022-11-05 19:38
Aoga.fi    81.19.116.172  (Time to Live: 7199)
oga.fi    81.19.116.171  (Time to Live: 7199)
AAAAoga.fi    2a02:ef0:100:1::171  (Time to Live: 7199)
oga.fi    2a02:ef0:100:1::172  (Time to Live: 7199)
MXoga-fi.mail.protection.outlook.com (Time to Live: 10800)
NSns-136-c.gandi.netns-233-a.gandi.netns-87-b.gandi.net
SOAoga.fi    ns1.gandi.net (Time to Live: 10800)
hostmaster.gandi.net
TXTgoogle-site-verification=Mw_kjnF8itYDR4jUDX8lc_-6D5ht38f56fjs6RQTwgY
SPF records:
v=spf1
a
mx
include:spf.protection.outlook.com
include:servers.mcsv.net
include:sendgrid.net
?all
MS=ms82179439



Whois record history for oga.fi

Source: Finnish Transport and Communications Agency (Traficom)
Showing latest max 5 detected changes in the records. Changes are highlighted
Date2018-05-052019-05-192019-09-282019-10-042021-01-19
Name oga.fi oga.fi oga.fi oga.fi oga.fi
State Registered Registered Registered Registered Registered
Holder Silmäkirurgia Pajari Oy Silmäkirurgia Pajari Oy Silmäkirurgia Pajari Oy Silmäkirurgia Pajari Oy Silmäkirurgia Pajari Oy
Address Pyynikintori 1 A 26 Pyynikintori 1 A 26 Pyynikintori 1 A 26 Pyynikintori 1 A 26 Pyynikintori 1 A 26
Country   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)
GrantDate 2017-05-24T08:33:54.417 2017-05-24T08:33:54.417 2017-05-24T08:33:54.417 2017-05-24T08:33:54.417 2017-05-24T08:33:54.417
Registrar Suomen Hostingpalvelu Oy Suomen Hostingpalvelu Oy Gandi SAS Gandi SAS Gandi SAS
PostalArea Tampere Tampere Tampere Tampere Tampere
PostalCode 33230 33230 33230 33230 33230
NameServer1 elle.ns.cloudflare.com elle.ns.cloudflare.com elle.ns.cloudflare.com ns-136-c.gandi.net ns-136-c.gandi.net
NameServer2 mitch.ns.cloudflare.com mitch.ns.cloudflare.com mitch.ns.cloudflare.com ns-233-a.gandi.net ns-233-a.gandi.net
PhoneNumber +358440608993 +358440608993 +358440608993 +358440608993 
IsDNSSecInUse no  no  no  no  no
OrganizationId 2060710-9 2060710-9 2060710-9 2060710-9 2060710-9
AssociationType Company Company Company Company Company
LastValidityDate 2022-05-24T08:33:54.417 2024-05-24T08:33:54.417 2024-05-24T08:33:54.417 2024-05-24T08:33:54.417 2024-05-24T08:33:54.417
DepartmentOrContactPerson     



Server response for oga.fi

Source: Web server reponse - Timestamp: 2022-11-05 19:38
Final URLhttps://oga.fi/
HTTP Return CodeHTTP/1.1 200 OK
IP Address
81.19.116.171 
Autonomous System (AS) #: 39242
BGP prefix: 81.19.112.0/20
Country Code:  Finland (FI)
Registry: ripencc
Allocated: 2005-11-15
Info: SECLAN, FI
Server HeaderServer: Nginx
Via:
Certificate Issued By: Let's Encrypt
Issuer details: O=Let's Encrypt,   United States (US)
Issuer details: CN=R3
Version: 2
Algorithm: RSA-SHA256
Issued On: 2022-10-03 00:00:00
Expires On: 2023-01-01 00:00:00
Certificate SubjectCountry (C):
Location (L):
Organization (O):
Common Name (CN): oga.fi
Certificate Alternative Namesoga.fi 
www.oga.fi 



Used technologies on oga.fi

Source: Web page analysis - Timestamp: 2022-11-05 19:38
Latest review2022-11-05 19:38
Page language (from header) (This is often false!)
Technologies



Known subdomains for oga.fi

Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700
Number of subdomains found: 4
SubdomainIP address
www.oga.fi 2a02:ef0:100:1::171 
2a02:ef0:100:1::172 
81.19.116.171 
81.19.116.172 



Web hosting providers

Source: All valid company websites with content (see below table)



Domains owned by same owner (current and past)

Source: Finnish Transport and Communications Agency (Traficom)
Number of domains: 3
Domain nameFinal URL
(when last tested)
LinksLast validity
oga.fi https://oga.fi/  
Details
Screenshot
2024-05-24
öga.fi https://oga.fi/  
Details
Screenshot
2024-05-24
ööga.fi No DNS records found  
Details
2024-10-20