kuninkaanlahde.fi  


Details
 
Server IP geolocation
 
Word cloud
 
Web page details & SOME
 
Cookie data
 
Screenshot
 
DNS records
 
Whois history
 
Server response
 
Used technologies
 
Subdomains
 
Hosting
 
Holders domains
 


Details

Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)
StateRegistered
Holder Kievarinkatu 5, Finland

Grant Date2010-03-19
Last Validity Date2025-03-19
Registrarwww design
38840 Niinisalo
Name Servers
Please see DNS section for details
ns1.nettipertti.fi
ns2.nettipertti.fi
Is The DNSSec in Use No
IANA details for suffixTop Level Domain (TLD): FI
TLD manager: Finnish Transport and Communications Agency Traficom
Domain type: Country-code



Server IP location

Source: Actual web page - Timestamp: 2022-11-10 16:31
WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP sourceIP addressASN block dataIP Geolocation
User IP34.239.158.223This is not retrieved for nowCountry: United States   (US)
State: Virginia (VA)
City: Ashburn
Postal code: 20149
Latitude: 39.0481
Longitude: -77.4728
Network: 34.239.0.0/16
Server IPAutonomous System (AS) #: 24940
BGP prefix: 95.217.0.0/16
Country Code: DE
Registry: ripencc
Allocated: 2009-02-24
Info: HETZNER-AS, DE
Country: Germany   (DE)
City:
Postal code:
Latitude: 51.2993
Longitude: 9.491
Network: 95.217.128.0/17

This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.



Word cloud for kuninkaanlahde.fi

Source: Actual web page - Timestamp: 2022-11-10 16:31
Notice: Miscellaneous words removed from the cloud to enhance the analytics



Web page details for kuninkaanlahde.fi

Source: Actual web page - Timestamp: 2022-12-04 09:14
Header data & Meta tagstitle Etusivu
viewport width=device-width, initial-scale=1, maximum-scale=1
not_found text/html; charset=utf-8
Open Graph (OG) meta tagsUsing Open Graph tags is highly recommended for Search Engine Optimization (SEO)
Twitter cardsUsing Twitter tags is highly recommended for Search Engine Optimization (SEO)
Cascading Style Sheets (CSS) (CSS)/media/jui/css/bootstrap-extended.css?dc91c115e2a5eabc1723245aa9a66810
/media/jui/css/icomoon.css
/media/system/css/modal.css?dc91c115e2a5eabc1723245aa9a66810
/media/jui/css/bootstrap.min.css?dc91c115e2a5eabc1723245aa9a66810
https://www.design.yt/components/com_jxtc/css.php?id=66&group=typo
https://www.design.yt/components/com_jxtc/css.php?id=66&group=grid
https://www.design.yt/templates/system/css/general.css
/media/jui/css/bootstrap-responsive.min.css?dc91c115e2a5eabc1723245aa9a66810
https://www.design.yt/components/com_jxtc/css.php?id=66&file=default
https://www.design.yt/templates/system/css/system.css
https://www.design.yt/modules/mod_jxtc_newspro/css/wall.css
//maxcdn.bootstrapcdn.com/font-awesome/latest/css/font-awesome.min.css
/plugins/system/jce/css/content.css?badb4208be409b1335b815dde676300e
https://www.design.yt/components/com_jxtc/css.php?id=66&group=style3
Social Media (SOME) linksHaving Social Media content is highly recommended for Search Engine Optimization (SEO)
JavaScript libraries/media/jui/js/jquery-noconflict.js?dc91c115e2a5eabc1723245aa9a66810
/media/jui/js/jquery.min.js?dc91c115e2a5eabc1723245aa9a66810
/components/com_jxtc/effects/smoothscroll.js
/templates/airflow/js/template.js
/components/com_jxtc/effects/scrollreveal.js
https://www.design.yt/media/joomlaxtc/wallfx.js
/media/system/js/core.js?dc91c115e2a5eabc1723245aa9a66810
/media/system/js/mootools-more.js?dc91c115e2a5eabc1723245aa9a66810
/media/jui/js/jquery-migrate.min.js?dc91c115e2a5eabc1723245aa9a66810
/components/com_jxtc/effects/sharer.min.js
/media/system/js/mootools-core.js?dc91c115e2a5eabc1723245aa9a66810
/media/system/js/caption.js?dc91c115e2a5eabc1723245aa9a66810
/media/system/js/modal.js?dc91c115e2a5eabc1723245aa9a66810
/media/jui/js/bootstrap.min.js?dc91c115e2a5eabc1723245aa9a66810



Cookie data for kuninkaanlahde.fi

Source: Actual web page - Timestamp: 2022-12-04 09:14
Number of cookies: 4
Cookie domainCookie values
design.ytCookie name: _gid
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 30 bytes
design.ytCookie name: _ga
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 30 bytes
design.ytCookie name: _gat
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 5 bytes
www.design.ytCookie name: 32058389035a4e17f6e96ab3326927a8
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 58 bytes



Screenshot for kuninkaanlahde.fi

Source: Actual web page - Timestamp: 2022-11-10 16:31
Screenshot for kuninkaanlahde.fi



DNS records for kuninkaanlahde.fi

Source: DNS reponse - Timestamp: 2022-11-10 16:31
Akuninkaanlahde.fi    95.217.149.110  (Time to Live: 3600)
MXposti.nettipertti.fi (Time to Live: 3600)
NSns2.nettipertti.fins1.nettipertti.fi
SOAkuninkaanlahde.fi    ns1.nettipertti.fi (Time to Live: 21600)
hostmaster.nettipertti.fi
TXTSPF records:
v=spf1
mx
~all



Whois record history for kuninkaanlahde.fi

Source: Finnish Transport and Communications Agency (Traficom)
Showing latest max 5 detected changes in the records. Changes are highlighted
Date2022-03-192023-03-222023-03-252024-03-222024-04-10
Name kuninkaanlahde.fi kuninkaanlahde.fi kuninkaanlahde.fi kuninkaanlahde.fi kuninkaanlahde.fi
State Registered Validity expired Registered Validity expired Registered
Holder www design www design www design www design www design
Address Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5
Country   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)
GrantDate 2010-03-19T10:14:59 2010-03-19T10:14:59 2010-03-19T10:14:59 2010-03-19T10:14:59 2010-03-19T10:14:59
Registrar www design www design www design www design www design
PostalArea Niinisalo Niinisalo Niinisalo Niinisalo Niinisalo
PostalCode 38840 38840 38840 38840 38840
NameServer1 ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi
NameServer2 ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi
PhoneNumber     
IsDNSSecInUse no  no  no  no  no
OrganizationId 2503281-8 2503281-8 2503281-8 2503281-8 2503281-8
AssociationType Company Company Company Company Company
LastValidityDate 2023-03-19T10:14:59 2023-03-19T10:14:59 2024-03-19T10:14:59 2024-03-19T10:14:59 2025-03-19T10:14:59
DepartmentOrContactPerson     



Server response for kuninkaanlahde.fi

Source: Web server reponse - Timestamp: 2022-11-10 16:31
Final URLhttps://www.design.yt/
HTTP Return CodeHTTP/1.1 200 OK
IP Address
95.217.149.110 
Autonomous System (AS) #: 24940
BGP prefix: 95.217.0.0/16
Country Code:  Germany (DE)
Registry: ripencc
Allocated: 2009-02-24
Info: HETZNER-AS, DE
Server HeaderServer: Apache
Via:
Certificate Issued By: Let's Encrypt
Issuer details: O=Let's Encrypt,   United States (US)
Issuer details: CN=R3
Version: 2
Algorithm: RSA-SHA256
Issued On: 2022-09-18 00:00:00
Expires On: 2022-12-17 00:00:00
Certificate SubjectCountry (C):
Location (L):
Organization (O):
Common Name (CN): design.yt
Certificate Alternative Namesdesign.yt 
www.design.yt 



Used technologies on kuninkaanlahde.fi

Source: Web page analysis - Timestamp: 2022-11-10 16:31
Latest review2022-11-10 16:31
Page language (from header)en-US (This is often false!)
TechnologiesSquarespace Squarespace (CMS) (100% propable)
Typekit Typekit 1.21.0 (Font Scripts) (100% propable)



Known subdomains for kuninkaanlahde.fi

Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700
No subdomains found



Web hosting providers

Source: All valid company websites with content (see below table)



Domains owned by same owner (current and past)

Source: Finnish Transport and Communications Agency (Traficom)
Number of domains: 161
Domain nameFinal URL
(when last tested)
LinksLast validity
4321.fi  
Details
Screenshot
Expired 2022-01-11
ad-kpaa.fi No DNS records found  
Details
2025-04-20
africar.fi No DNS records found  
Details
2025-02-12
ahofarm.fi  
Details
Expired 2000-12-31
airportpark.fi http://www.airportpark.fi/  
Details
Screenshot
2025-01-16
ammattikalastusmessut.fi No DNS records found  
Details
2025-03-14
auto-sabo.fi http://www.auto-sabo.fi/  
Details
Screenshot
2024-08-06
autosabo.fi http://www.autosabo.fi/  
Details
Screenshot
2024-08-06
avainauto.fi  
Details
Screenshot
Expired 2022-07-31
benzboy.fi  
Details
Expired 2018-08-14
design-suomi.fi  
Details
Screenshot
Expired 2019-10-23
discgolfstore.fi https://www.frisbeegolf-forum.fi/  
Details
Screenshot
2025-02-08
driveit.fi  
Details
Screenshot
Expired 2020-01-22
elinvoimainenkankaanpaa.fi  
Details
Screenshot
Expired 2023-09-06
eurogarment.fi  
Details
Screenshot
Expired 2020-07-05
fixus-kankaanpaa.fi  
Details
Screenshot
Expired 2023-03-31
frisbeegolf-forum.fi http://www.frisbeegolf-forum.fi/  
Details
Screenshot
2025-01-01
frisbeegolfkauppa.fi http://www.frisbeegolfkauppa.fi/  
Details
Screenshot
2025-02-08
futsalforum.fi http://www.futsalforum.fi/  
Details
Screenshot
2024-12-13
geopark-suomi.fi  
Details
Expired 2023-04-30
grillivaunut.fi http://www.grillivaunut.fi/  
Details
Screenshot
2025-01-18
hatax.fi No DNS records found  
Details
2024-12-03
hennakyrojoki.fi No DNS records found  
Details
2025-01-26
hevosenhetki.fi  
Details
Screenshot
Expired 2021-05-25
hotellitoholampi.fi  
Details
Screenshot
Expired 2019-08-14
ideaparkopen.fi No DNS records found  
Details
2025-04-08
ilmalampopumppukauppa.fi http://www.ilmalampopumppukauppa.fi/  
Details
Screenshot
2024-06-14
ilmavideot.fi http://www.ilmavideot.fi/  
Details
Screenshot
2024-08-26
itpaja.fi  
Details
Screenshot
Expired 2020-03-23
itpalvelukallionkieli.fi  
Details
Screenshot
Expired 2020-05-02
jaanantaksi.fi No DNS records found  
Details
2024-12-13
jk-inks.fi  
Details
Expired 2018-12-10
jvsahkoasennus.fi http://www.jvsahkoasennus.fi/  
Details
Screenshot
2024-08-04
jvsähköasennus.fi http://www.xn--jvshkasennus-icb8w.fi/  
Details
Screenshot
2024-08-04
kalastustukku.fi  
Details
Screenshot
Expired 2024-01-22
kama1958.fi http://www.kama1958.fi/  
Details
Screenshot
2024-06-14
kangasfysio.fi  
Details
Screenshot
Expired 2020-02-04
kankaanpaanautohuolto.fi No DNS records found  
Details
2025-03-10
kankaanpaanjoulu.fi  
Details
Screenshot
Expired 2019-11-02
kankaanpäänjoulu.fi  
Details
Screenshot
Expired 2019-11-02
kankaanpaanlasi.fi https://xn--kankaanpnlasi-ifba.fi/  
Details
Screenshot
2024-12-13
kankaanpäänlasi.fi https://xn--kankaanpnlasi-ifba.fi/  
Details
Screenshot
2024-08-26
kankaanpaanmetsastysyhdistys.fi No DNS records found  
Details
2024-11-22
kankaanpäänmetsastysyhdistys.fi http://kankaanpaanmetsastysyhdistys.fi/  
Details
Screenshot
2024-11-22
kankaanpäänmetsästysyhdistys.fi http://kankaanpaanmetsastysyhdistys.fi/  
Details
Screenshot
2025-02-26
kankaanpaanomaishoitajat.fi http://www.kankaanpaanomaishoitajat.fi/  
Details
Screenshot
2025-02-01
katalysaattorit.fi http://www.katalysaattorit.fi/  
Details
Screenshot
2025-02-19
katsastusasemat.fi  
Details
Screenshot
Expired 2024-03-26
kaupunkiseikkailu.fi  
Details
Expired 2024-05-10
keilailuliitto.fi http://www.keilailuliitto.fi/  
Details
Screenshot
2025-01-15
kerola.fi http://www.kerola.fi/  
Details
Screenshot
2025-01-16
keskofood.fi http://www.keskofood.fi/  
Details
2025-01-15
kesyry.fi https://kesyry.fi/  
Details
Screenshot
2025-03-22
kiikanwallin.fi No DNS records found  
Details
2024-07-30
konsulentit.fi No DNS records found  
Details
2024-08-27
konsulentti.fi http://dan.com/buy-domain/konsulentti.fi?redirected=true  
Details
Screenshot
2024-08-27
koota.fi No DNS records found  
Details
2025-01-15
kotiyleiso.fi  
Details
Screenshot
Expired 2019-06-21
kpaalasi.fi http://www.kpaalasi.fi/  
Details
Screenshot
2025-02-17
kuninkaanlahde.fi https://www.design.yt/  
Details
Screenshot
2025-03-19
kuninkaanlähde.fi http://www.xn--kuninkaanlhde-kfb.fi/  
Details
Screenshot
2025-03-03
kuntoutuskumppani.fi No DNS records found  
Details
2024-09-29
kuntoutuspaikkasi.fi No DNS records found  
Details
2025-01-13
kyrojoki.fi No DNS records found  
Details
2025-01-27
laboratoriotarvike.fi  
Details
Screenshot
Expired 2023-02-03
lammoneriste.fi  
Details
Screenshot
Expired 2023-02-02
lämmöneriste.fi  
Details
Screenshot
Expired 2023-02-02
lämpöpumppukauppa.fi https://wattila.fi/  
Details
Screenshot
2025-01-30
lampopumppukeskus.fi  
Details
Screenshot
Expired 2024-02-25
lampopumppuvaraosat.fi No DNS records found  
Details
2025-01-16
lauantaitorit.fi https://design.yt/  
Details
Screenshot
2025-04-05
lekatec.fi  
Details
Screenshot
Expired 2021-07-30
lelesb.fi http://www.lelesb.fi/  
Details
Screenshot
2024-08-11
lemppu.fi http://www.lemppu.fi/  
Details
Screenshot
2024-05-25
lemppulegends.fi No DNS records found  
Details
2024-08-25
leppisfishing.fi  
Details
Screenshot
Expired 2022-03-26
levinhenkireika.fi https://levinhenkireika.fi/  
Details
Screenshot
2025-05-02
löytökorpi.fi No DNS records found  
Details
2025-03-17
maila.fi http://www.maila.fi/  
Details
Screenshot
2025-02-22
meggala.fi  
Details
Screenshot
Expired 2021-12-27
metsastyskeskustelu.fi  
Details
Screenshot
Expired 2024-01-22
mkenergiakuljetus.fi No DNS records found  
Details
2024-08-14
mm-kaupat.fi https://www.nettiauto.com/yritys/343149  
Details
Screenshot
2024-06-06
monioljypoltin.fi  
Details
Screenshot
Expired 2024-05-21
monioljypolttimenvaraosat.fi http://www.monioljypolttimenvaraosat.fi/  
Details
Screenshot
2024-11-16
monioljypolttimet.fi https://www.monioljypolttimet.fi/  
Details
Screenshot
2024-08-26
mpvarikko.fi  
Details
Screenshot
Expired 2021-05-03
murskamies.fi http://www.murskamies.fi/  
Details
Screenshot
2024-12-30
myyntivaunut.fi https://www.myyntivaunut.fi/  
Details
Screenshot
2024-05-30
neoen.fi http://www.neoen.fi/  
Details
Screenshot
2024-09-29
neoen-finland.fi http://www.neoen-finland.fi/  
Details
Screenshot
2024-09-29
nesvuokrapelit.fi  
Details
Screenshot
Expired 2000-12-31
nettipalvelin.fi http://www.nettipalvelin.fi/  
Details
Screenshot
2025-01-11
nettipertti.fi http://design.yt/  
Details
2024-12-02
nibevaraosat.fi No DNS records found  
Details
2025-01-16
nonstopparturi.fi http://www.nonstopparturi.fi/  
Details
Screenshot
2024-12-03
northecoclean.fi  
Details
Screenshot
Expired 2021-09-29
nuhvi.fi https://www.nuhvi.fi/index.php/fi/  
Details
Screenshot
2025-02-25
ohjelmasiili.fi  
Details
Screenshot
Expired 2019-08-24
öljysäiliö.fi  
Details
Screenshot
Expired 2022-03-25
olkimix.fi  
Details
Screenshot
Expired 2019-06-26
oulunautohuolto.fi http://www.oulunautohuolto.fi/  
Details
Screenshot
2025-01-22
oxdog.fi http://www.oxdog.fi/  
Details
Screenshot
2024-11-20
pauliinap.fi  
Details
Screenshot
Expired 2000-12-31
pe-53.fi  
Details
Expired 2019-01-01
pelaajaboardcast.fi https://pelaajaboardcast.fi/  
Details
Screenshot
2024-10-07
pesapalloforum.fi http://www.pesapalloforum.fi/  
Details
Screenshot
2025-01-18
pesisforum.fi No DNS records found  
Details
2026-01-18
pesisportaali.fi http://www.pesisportaali.fi/  
Details
Screenshot
2025-01-05
pienisuuriidea.fi https://pienisuuriidea.fi/  
Details
Screenshot
2024-10-15
pirkanmaanpohjarakennus.fi https://pirkanmaanpohjarakennus.fi/  
Details
Screenshot
2024-09-23
pomarkunpyry.fi https://design.yt/  
Details
Screenshot
2025-03-09
pompy.fi https://design.yt/  
Details
Screenshot
2025-03-09
porintilausajo.fi http://www.porintilausajo.fi/  
Details
Screenshot
2025-01-15
ps82.fi  
Details
Expired 2018-03-07
putkiasennusta.fi  
Details
Screenshot
Expired 2023-01-22
rajalamotorsport.fi  
Details
Screenshot
Expired 2024-04-30
rakennuskiviranta.fi  
Details
Screenshot
Expired 2020-03-02
rakennuspalvelujarvinen.fi No DNS records found  
Details
2025-04-21
reseptikilpailu.fi  
Details
Expired 2021-12-06
retkilemi.fi No DNS records found  
Details
2024-08-03
roskala.fi  
Details
Screenshot
Expired 2000-12-31
rudanco.fi https://rudanco.fi/  
Details
Screenshot
2024-08-09
sahkomopo.fi No DNS records found  
Details
2025-01-15
sähkösun.fi http://www.xn--shksun-bua0m.fi/  
Details
2024-07-27
salibandyforum.fi http://www.salibandyforum.fi/  
Details
Screenshot
2025-01-04
salonsaxin.fi http://www.salonsaxin.fi/  
Details
Screenshot
2025-05-15
sarmeen.fi http://www.sarmeen.fi/  
Details
Screenshot
2024-05-25
satakunnantaksi.fi  
Details
Screenshot
Expired 2024-03-24
satakunnantieisannointi.fi https://satakunnantieisannointi.fi/  
Details
Screenshot
2025-03-05
satakunnanurheiluklinikka.fi  
Details
Screenshot
Expired 2021-09-13
sillanmaki.fi https://www.sillanmaki.fi/  
Details
Screenshot
2024-12-11
sinituuli.fi http://www.sinituuli.fi/  
Details
Screenshot
2025-01-16
snowracers.fi  
Details
Screenshot
Expired 2023-09-12
solarsuomi.fi https://www.solar.eu/  
Details
Screenshot
2025-01-15
suomenravintolalaite.fi https://suomenravintolalaite.fi/  
Details
Screenshot
2024-09-06
tacogarcia.fi  
Details
Screenshot
Expired 2022-01-05
taksileponiemi.fi http://www.taksileponiemi.fi/  
Details
Screenshot
2024-12-14
tapahtumaviikko.fi  
Details
Screenshot
Expired 2023-01-22
teollisuusimuri.fi  
Details
Screenshot
Expired 2023-03-11
tiinajalasse.fi  
Details
Expired 2019-02-26
tilataksipori.fi https://tilataksipori.fi/  
Details
Screenshot
2025-02-12
tomoottajat.fi http://www.tomoottajat.fi/  
Details
Screenshot
2025-03-19
traktoripalvelu.fi http://www.traktoripalvelu.fi/  
Details
Screenshot
2025-01-16
trukkikortti.fi  
Details
Screenshot
Expired 2022-03-26
turunsinappi.fi https://www.turunsinappia.fi/  
Details
Screenshot
2025-01-15
unf.fi http://www.unf.fi/  
Details
Screenshot
2025-01-15
valokuvaajapauliinap.fi  
Details
Screenshot
Expired 2000-12-31
varastoon.fi https://www.tilacenter.fi/  
Details
Screenshot
2024-08-19
varisuora.fi http://www.varisuora.fi/  
Details
Screenshot
2025-01-16
verkkokauppakorpela.fi http://www.verkkokauppakorpela.fi/  
Details
Screenshot
2024-11-16
vervevara.fi  
Details
Screenshot
Expired 2023-06-20
vientiautot.fi https://www.vientiautot.fi/  
Details
Screenshot
2025-05-10
vihapulla.fi No DNS records found  
Details
2025-01-26
vikailmoitukset.fi http://www.vikailmoitukset.fi/  
Details
Screenshot
2025-01-16
vikapihalle.fi  
Details
Screenshot
Expired 2021-10-11
volvo-ohjelmointi.fi  
Details
Expired 2022-10-21
volvoohjelmointi.fi  
Details
Screenshot
Expired 2022-10-21
wwwdesign.fi http://www.wwwdesign.fi/  
Details
Screenshot
2025-01-11
yli-rami.fi http://www.yli-rami.fi/  
Details
Screenshot
2025-02-08
yritysesittelyvideo.fi http://www.yritysesittelyvideo.fi/  
Details
Screenshot
2025-01-22